PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_69.81 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 143aa MW: 16442.4 Da PI: 7.7756 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.8 | 5e-10 | 85 | 119 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+++++ LA+++gL+++q+ +WF N+R ++ evm.model.supercontig_69.81 85 KWPYPTEADKNALADSTGLDQKQINNWFINQRKRH 119 569*****************************985 PP | |||||||
2 | ELK | 26.8 | 1.2e-09 | 39 | 60 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ++K+ Llr ++++++sLk EFs evm.model.supercontig_69.81 39 DIKDKLLRRFGSHISSLKLEFS 60 58*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 1.8E-4 | 39 | 60 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 9.202 | 39 | 59 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.3E-7 | 39 | 60 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.633 | 59 | 122 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 5.13E-20 | 60 | 133 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 6.2E-13 | 61 | 126 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-28 | 64 | 123 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.98E-12 | 68 | 123 | No hit | No description |
Pfam | PF05920 | 6.0E-18 | 79 | 118 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 97 | 120 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MKIENDKVVS EDGAASSEDE FSGGEIEVQE GQPRSDDQDI KDKLLRRFGS HISSLKLEFS 60 KKKKKGKLPR EARQILLSWW NVHYKWPYPT EADKNALADS TGLDQKQINN WFINQRKRHW 120 KPSENMPFGL MDNISGQFFT GD* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_69.81 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021895815.1 | 4e-95 | homeobox protein knotted-1-like 6 | ||||
Swissprot | Q84JS6 | 2e-67 | KNAT6_ARATH; Homeobox protein knotted-1-like 6 | ||||
TrEMBL | A0A061EE17 | 5e-70 | A0A061EE17_THECC; KNOTTED1-like homeobox gene 6 | ||||
STRING | evm.model.supercontig_69.81 | 1e-101 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 | Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 7e-62 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_69.81 |
Publications ? help Back to Top | |||
---|---|---|---|
|