PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_46.144 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 25068.7 Da PI: 8.4689 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.2 | 2.1e-19 | 37 | 84 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+++++ +G+++Wk Ia++ g++R++k+c++rw +yl evm.model.supercontig_46.144 37 KGTWTAEEDRKLAEVIAIHGTKRWKIIAAKAGLNRCGKSCRLRWMNYL 84 799*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 51.7 | 2e-16 | 90 | 135 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l evm.model.supercontig_46.144 90 RGNISEQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 135 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.731 | 32 | 88 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.26E-30 | 35 | 131 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.5E-17 | 36 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-18 | 37 | 84 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-24 | 38 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.44E-11 | 39 | 84 | No hit | No description |
SMART | SM00717 | 7.1E-16 | 89 | 137 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.312 | 89 | 139 | IPR017930 | Myb domain |
Pfam | PF00249 | 5.6E-15 | 90 | 135 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-25 | 92 | 139 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.26E-10 | 94 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MGRKVDHDEN IKGEMIMKPL EEAVLKDMST TKKDVNKGTW TAEEDRKLAE VIAIHGTKRW 60 KIIAAKAGLN RCGKSCRLRW MNYLRPNIKR GNISEQEEDL ILRLHKLLGN RWSLIAGRLP 120 GRTDNEIKNY WNSHLSKKIE LKDRQSGASE IREMYVGEKR KVMESKEINL EVMKEEEING 180 CNGGEGSPSG SFNVDDFFDF SNEDPLNLEW MSRFVQL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-31 | 34 | 140 | 4 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_46.144 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021899340.1 | 1e-159 | transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 2e-53 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A067KX10 | 1e-93 | A0A067KX10_JATCU; MYB family protein | ||||
STRING | evm.model.supercontig_46.144 | 1e-158 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 6e-56 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_46.144 |