PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_435.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 199aa MW: 22898.6 Da PI: 9.9996 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.2 | 3.2e-53 | 12 | 138 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 lppGfrFhP+deel+ +yL+kkv++k+l++ +vi+e+d+yk++Pw+Lpk++ +++ew+fFs+rd+ky++g r+nra++sgy evm.model.supercontig_435.1 12 LPPGFRFHPSDEELIIHYLQKKVTSKPLPA-SVIAEIDLYKHNPWELPKQALFGDDEWFFFSPRDRKYPNGARPNRAAASGY 92 79****************************.99***************8888899*************************** PP NAM 83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 Wkatg+dk++l+++++ +g+kk+Lvfy gr pkg kt+W+m+eyrl evm.model.supercontig_435.1 93 WKATGTDKPILTSGSKSIGVKKSLVFYIGRPPKGAKTNWIMNEYRL 138 ********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.71E-63 | 8 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.441 | 12 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.8E-27 | 13 | 138 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MEVGEHNPIF HLPPGFRFHP SDEELIIHYL QKKVTSKPLP ASVIAEIDLY KHNPWELPKQ 60 ALFGDDEWFF FSPRDRKYPN GARPNRAAAS GYWKATGTDK PILTSGSKSI GVKKSLVFYI 120 GRPPKGAKTN WIMNEYRLLD TMIKPPRLKE SMRLDDWVLC RVRKKDMIKN MCEARDNNST 180 ESCIRPLQDV CLRAIRTI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swm_B | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swm_C | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swm_D | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swp_A | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swp_B | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swp_C | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
3swp_D | 3e-71 | 1 | 165 | 7 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_435.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021909397.1 | 1e-135 | NAC transcription factor 25-like | ||||
Swissprot | Q8GY42 | 3e-81 | NAC25_ARATH; NAC transcription factor 25 | ||||
TrEMBL | A0A061GT65 | 3e-99 | A0A061GT65_THECC; NAC domain containing protein 25, putative | ||||
STRING | evm.model.supercontig_435.1 | 1e-147 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17984 | 6 | 7 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G61110.1 | 1e-83 | NAC domain containing protein 25 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_435.1 |