PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_43.138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRF
Protein Properties Length: 167aa    MW: 18342.8 Da    PI: 9.5773
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_43.138genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC59.74.9e-191191541045
                           WRC  10 tDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                                   tDGKkWRCs+++++++ +CErH+hrgr+rsrk++e+
  evm.model.supercontig_43.138 119 TDGKKWRCSKDAYPDSEYCERHMHRGRNRSRKPVES 154
                                   9********************************986 PP

2QLQ65.81.1e-222359137
                           QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                                  s+FT +Q+q+L++Q+l++Ky++a++PvPp+L+++iqk
  evm.model.supercontig_43.138 23 SPFTVSQWQELEHQALIFKYMMAGLPVPPDLVLPIQK 59
                                  89*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-122359IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166624.4982459IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-162458IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166717.069110154IPR014977WRC domain
PfamPF088796.3E-16119153IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MNSGGGNGGG SGGGGTGMMA MRSPFTVSQW QELEHQALIF KYMMAGLPVP PDLVLPIQKS  60
FESISHRFFH HPTRTLASMG IILNAARTPC QYSSSFGLVW VIVPSTGKRW IQSLDDAETD  120
GKKWRCSKDA YPDSEYCERH MHRGRNRSRK PVESQTMTQS SSTVSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1215SGGGNGGGSGGGGT
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269|PubMed:24532604, ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747, ECO:0000269|PubMed:27250749, ECO:0000305|PubMed:26187814, ECO:0000305|PubMed:27107174, ECO:0000305|PubMed:27250747, ECO:0000305|PubMed:27250749}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_43.138
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269|PubMed:26187814, ECO:0000269|PubMed:26936408, ECO:0000269|PubMed:27107174, ECO:0000269|PubMed:27250747}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819151e-53LN681915.1 Cucumis melo genomic scaffold, anchoredscaffold00070.
GenBankLN7132651e-53LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021899781.12e-67LOW QUALITY PROTEIN: growth-regulating factor 4-like
RefseqXP_024447118.12e-66growth-regulating factor 4
SwissprotQ6ZIK52e-40GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A2K1WPD65e-65A0A2K1WPD6_POPTR; Uncharacterized protein
STRINGevm.model.supercontig_43.1381e-122(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM143391019
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-32growth-regulating factor 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  3. Hu J, et al.
    A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice.
    Mol Plant, 2015. 8(10): p. 1455-65
    [PMID:26187814]
  4. Sun P, et al.
    OsGRF4 controls grain shape, panicle length and seed shattering in rice.
    J Integr Plant Biol, 2016. 58(10): p. 836-847
    [PMID:26936408]
  5. Li S, et al.
    The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice.
    Plant Biotechnol. J., 2016. 14(11): p. 2134-2146
    [PMID:27107174]
  6. Che R, et al.
    Control of grain size and rice yield by GL2-mediated brassinosteroid responses.
    Nat Plants, 2015. 2: p. 15195
    [PMID:27250747]
  7. Duan P, et al.
    Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice.
    Nat Plants, 2015. 2: p. 15203
    [PMID:27250749]