PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_4.204 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 62aa MW: 6985.07 Da PI: 10.1665 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.9 | 2.4e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss evm.model.supercontig_4.204 9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQNGRLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.5E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.618 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.62E-38 | 3 | 60 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.79E-30 | 3 | 60 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.0E-29 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.1E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 62 aa Download sequence Send to blast |
MVRGKVEMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ NGRLYEFSSS 60 E* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-19 | 1 | 61 | 1 | 61 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_4.204 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024163622.1 | 3e-35 | MADS-box protein AGL42-like isoform X4 | ||||
Refseq | XP_024163722.1 | 2e-35 | MADS-box protein AGL42-like isoform X5 | ||||
Swissprot | Q9FIS1 | 3e-33 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A1Q3B1F1 | 2e-33 | A0A1Q3B1F1_CEPFO; SRF-TF domain-containing protein/K-box domain-containing protein | ||||
TrEMBL | A0A2P6SMT4 | 2e-33 | A0A2P6SMT4_ROSCH; Putative transcription factor MADS-MIKC family | ||||
STRING | evm.model.supercontig_4.204 | 8e-37 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 | Representative plant | OGRP16 | 17 | 761 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.4 | 1e-35 | AGAMOUS-like 42 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_4.204 |