PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_4.204
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 62aa    MW: 6985.07 Da    PI: 10.1665
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_4.204genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF101.92.4e-32959151
                                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                 krien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss
  evm.model.supercontig_4.204  9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQNGRLYEFSS 59
                                 79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.5E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.618161IPR002100Transcription factor, MADS-box
CDDcd002658.62E-38360No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-30360IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-32323IPR002100Transcription factor, MADS-box
PfamPF003195.0E-291057IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MVRGKVEMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ NGRLYEFSSS  60
E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19161161Myocyte-specific enhancer factor 2B
1tqe_Q5e-19161161Myocyte-specific enhancer factor 2B
1tqe_R5e-19161161Myocyte-specific enhancer factor 2B
1tqe_S5e-19161161Myocyte-specific enhancer factor 2B
6c9l_A5e-19161161Myocyte-specific enhancer factor 2B
6c9l_B5e-19161161Myocyte-specific enhancer factor 2B
6c9l_C5e-19161161Myocyte-specific enhancer factor 2B
6c9l_D5e-19161161Myocyte-specific enhancer factor 2B
6c9l_E5e-19161161Myocyte-specific enhancer factor 2B
6c9l_F5e-19161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_4.204
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024163622.13e-35MADS-box protein AGL42-like isoform X4
RefseqXP_024163722.12e-35MADS-box protein AGL42-like isoform X5
SwissprotQ9FIS13e-33AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A1Q3B1F12e-33A0A1Q3B1F1_CEPFO; SRF-TF domain-containing protein/K-box domain-containing protein
TrEMBLA0A2P6SMT42e-33A0A2P6SMT4_ROSCH; Putative transcription factor MADS-MIKC family
STRINGevm.model.supercontig_4.2048e-37(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.41e-35AGAMOUS-like 42