PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_331.6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 59aa MW: 6514.69 Da PI: 10.3007 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 72.6 | 7.6e-23 | 13 | 59 | 1 | 47 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47 +CaaCk+lrr+Ca++Cv+apyfpa++p+kfa vhk+FGasnv k+l+ evm.model.supercontig_331.6 13 PCAACKLLRRRCAQECVFAPYFPADEPQKFASVHKVFGASNVNKMLQ 59 7********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 18.145 | 12 | 59 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.8E-22 | 13 | 59 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 59 aa Download sequence Send to blast |
MKVSGRKQGA LSPCAACKLL RRRCAQECVF APYFPADEPQ KFASVHKVFG ASNVNKMLQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-22 | 9 | 59 | 7 | 57 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-22 | 9 | 59 | 7 | 57 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_331.6 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002513395.1 | 1e-35 | LOB domain-containing protein 4 | ||||
Refseq | XP_021644716.1 | 1e-35 | LOB domain-containing protein 4-like | ||||
Swissprot | Q9SHE9 | 1e-32 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
TrEMBL | A0A2P5DV54 | 2e-34 | A0A2P5DV54_PARAD; Lateral organ boundaries domain containing protein | ||||
STRING | evm.model.supercontig_331.6 | 2e-36 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 | Representative plant | OGRP60 | 16 | 318 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G31320.1 | 4e-35 | LOB domain-containing protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_331.6 |