PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.model.supercontig_29.114

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

MYB_related

Protein Properties

Length: 98aa MW: 11218.3 Da PI: 9.5658

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.model.supercontig_29.114	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53	8e-17	14	60	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+WT+eEd++l++ + G +W+++++ g++R++k+c++rw +y evm.model.supercontig_29.114 14 KGPWTAEEDKKLINFIITNGHCCWRAVPKLAGLRRCGKSCRLRWTNY 60 79********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.1E-22	5	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.872	9	65	IPR017930	Myb domain
SMART	SM00717	9.1E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.6E-15	14	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.15E-19	15	88	IPR009057	Homeodomain-like
CDD	cd00167	1.32E-9	16	61	No hit	No description
PROSITE profile	PS50090	4.077	62	97	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	6.5E-5	64	87	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFII TNGHCCWRAV PKLAGLRRCG KSCRLRWTNY 60 FRPDLKRGLL TDFEEQLVID LHARLGNSLL TCKLCWI*

Functional Description ? help Back to Top
Source	Description
UniProt	R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269\|PubMed:15805488}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.model.supercontig_29.114

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021725517.1	2e-57	protein ODORANT1-like
Refseq	XP_021901708.1	8e-59	protein ODORANT1, partial
Swissprot	Q50EX6	2e-53	ODO1_PETHY; Protein ODORANT1
TrEMBL	A0A218WGN9	8e-55	A0A218WGN9_PUNGR; Uncharacterized protein
TrEMBL	A0A2I0JT83	3e-55	A0A2I0JT83_PUNGR; Uncharacterized protein
TrEMBL	W9QU23	2e-54	W9QU23_9ROSA; Protein ODORANT1
STRING	evm.model.supercontig_29.114	1e-65	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G12350.1	3e-56	myb domain protein 42

Link Out ? help Back to Top
Phytozome	evm.model.supercontig_29.114

Publications ? help Back to Top
Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC ODORANT1 regulates fragrance biosynthesis in petunia flowers. Plant Cell, 2005. 17(5): p. 1612-24 [PMID:15805488]