PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_21.11 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 227aa MW: 25384 Da PI: 8.7368 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 85.7 | 2.8e-27 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ien + rqvtfskRr g++KKA ELSvLCda+va+i+fs tgkl++y+s evm.model.supercontig_21.11 10 KIENVTARQVTFSKRRRGLFKKADELSVLCDADVALIVFSATGKLFDYCS 59 69**********************************************96 PP | |||||||
2 | K-box | 46.5 | 1.6e-16 | 95 | 173 | 21 | 99 |
K-box 21 lakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +L kei +++R+++GedL+ L+++ LqqLe+ Le +l ++ + K+e ++++i+ l +k +l een++L++k+ evm.model.supercontig_21.11 95 RIRLSKEIADKSHQLRQMKGEDLQGLNVEKLQQLEKMLEAGLGRVVQMKSEKITSEISALERKGAQLMEENQKLKEKMR 173 55788888888999**************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.408 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.7E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.17E-37 | 2 | 77 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.97E-30 | 3 | 77 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.7E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.068 | 88 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.8E-16 | 92 | 172 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MAREKIRIRK IENVTARQVT FSKRRRGLFK KADELSVLCD ADVALIVFSA TGKLFDYCSS 60 RSSMKDMLSR YNMHSNNVNK LEPPPLELQI ENNNRIRLSK EIADKSHQLR QMKGEDLQGL 120 NVEKLQQLEK MLEAGLGRVV QMKSEKITSE ISALERKGAQ LMEENQKLKE KMREICKGKK 180 GGVLETDVGL HEEGLSSESV NNTNACSCSS GPPPEDDSSD TSLRLG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 5e-17 | 1 | 75 | 1 | 73 | MEF2C |
5f28_B | 5e-17 | 1 | 75 | 1 | 73 | MEF2C |
5f28_C | 5e-17 | 1 | 75 | 1 | 73 | MEF2C |
5f28_D | 5e-17 | 1 | 75 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_21.11 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021903451.1 | 1e-165 | MADS-box protein SVP-like isoform X2 | ||||
Swissprot | Q9FVC1 | 1e-91 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A061FLR3 | 1e-115 | A0A061FLR3_THECC; K-box region and MADS-box transcription factor family protein | ||||
STRING | evm.model.supercontig_21.11 | 1e-164 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4190 | 27 | 47 | Representative plant | OGRP6076 | 11 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 1e-86 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_21.11 |