PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_202.7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 142aa MW: 16119.5 Da PI: 9.8851 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 81.7 | 1.5e-25 | 60 | 130 | 57 | 128 |
NAM 57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 fF++ d+ky++g+r n+atk+g Wkatgkd++++s + +l+g kktLvfy+grap+ +kt+ vmheyr evm.model.supercontig_202.7 60 PELFFCPLDRKYPNGSRLNKATKAGHWKATGKDRKITS-GVNLIGRKKTLVFYTGRAPEEKKTNCVMHEYRT 130 447***********************************.999****************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 23.702 | 1 | 141 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.3E-11 | 46 | 129 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.7E-25 | 63 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MTTNKERIEN LEASMDKLQG RLSRMEVGFA AKFYQIEDIL KRLTDMLLVN CERSSSNIDP 60 ELFFCPLDRK YPNGSRLNKA TKAGHWKATG KDRKITSGVN LIGRKKTLVF YTGRAPEEKK 120 TNCVMHEYRT TEDDLNGTKP G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-22 | 63 | 132 | 75 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-22 | 63 | 132 | 75 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-22 | 63 | 132 | 75 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-22 | 63 | 132 | 75 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swm_B | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swm_C | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swm_D | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swp_A | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swp_B | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swp_C | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
3swp_D | 1e-22 | 63 | 132 | 78 | 147 | NAC domain-containing protein 19 |
4dul_A | 1e-22 | 63 | 132 | 75 | 144 | NAC domain-containing protein 19 |
4dul_B | 1e-22 | 63 | 132 | 75 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:20156199, PubMed:19947982). Transcriptional activator involved in response to cold stress. Mediates induction of pathogenesis-related (PR) genes independently of salicylic signaling in response to cold. Binds directly to the PR gene promoters and enhances plant resistance to pathogen infection, incorporating cold signals into pathogen resistance responses (PubMed:19947982). Plays a regulatory role in abscisic acid (ABA)-mediated drought-resistance response (PubMed:22967043). {ECO:0000269|PubMed:19947982, ECO:0000269|PubMed:20156199, ECO:0000269|PubMed:22967043}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_202.7 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salt, drought stress, abscisic acid (ABA), salicylic acid (SA) and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC238607 | 9e-91 | AC238607.1 Carica papaya BAC clone 53G04, complete sequence. | |||
GenBank | CP010988 | 9e-91 | CP010988.1 Carica papaya chromosome Y sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021909576.1 | 2e-40 | NAC domain-containing protein 62-like | ||||
Swissprot | Q9SCK6 | 2e-34 | NAC62_ARATH; NAC domain-containing protein 62 | ||||
TrEMBL | A0A061G1N1 | 9e-38 | A0A061G1N1_THECC; NAC domain class transcription factor, putative isoform 2 | ||||
TrEMBL | A0A061G9N7 | 1e-37 | A0A061G9N7_THECC; NAC domain class transcription factor, putative isoform 1 | ||||
TrEMBL | A0A1U8JU51 | 1e-37 | A0A1U8JU51_GOSHI; NAC domain-containing protein 62-like | ||||
STRING | evm.model.supercontig_202.7 | 1e-102 | (Carica papaya) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49530.1 | 7e-37 | NAC domain containing protein 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_202.7 |
Publications ? help Back to Top | |||
---|---|---|---|
|