PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_152.56 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 153aa MW: 17945.2 Da PI: 7.663 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.5 | 6.3e-10 | 80 | 114 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yps++++ LA+++gL+++q+ +WF N+R ++ evm.model.supercontig_152.56 80 KWPYPSEQQKLALAESTGLDQKQINNWFINQRKRH 114 569*****************************985 PP | |||||||
2 | ELK | 42.7 | 1.1e-14 | 34 | 55 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK qLlrKYsgyLgsLkqEF+ evm.model.supercontig_152.56 34 ELKGQLLRKYSGYLGSLKQEFM 55 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 2.8E-8 | 34 | 55 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.174 | 34 | 54 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.9E-11 | 34 | 55 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 13.119 | 54 | 117 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 4.28E-20 | 56 | 131 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 9.9E-13 | 56 | 121 | IPR001356 | Homeobox domain |
CDD | cd00086 | 2.60E-13 | 57 | 118 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-28 | 59 | 119 | IPR009057 | Homeodomain-like |
Pfam | PF05920 | 8.0E-18 | 74 | 113 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 92 | 115 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009934 | Biological Process | regulation of meristem structural organization | ||||
GO:0048440 | Biological Process | carpel development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MQSGCGDGID RNGSSEEEVD VNNEFIDPQA EDRELKGQLL RKYSGYLGSL KQEFMKKRKK 60 GKLPREARQQ LLDWWSRHYK WPYPSEQQKL ALAESTGLDQ KQINNWFINQ RKRHWKPSED 120 MQFVVMDATH PHYYMDNVLG NPFPMDITPT LL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 49 | 58 | LKQEFMKKRK |
2 | 55 | 59 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | May have a role to play in formative events in ovule and embryo morphogenesis. Probably binds to the DNA sequence 5'-TGAC-3'. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_152.56 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021889118.1 | 1e-112 | homeobox protein SBH1 | ||||
Swissprot | O22299 | 1e-89 | LET6_SOLLC; Homeobox protein knotted-1-like LET6 | ||||
TrEMBL | D3IWE9 | 2e-98 | D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2 | ||||
STRING | evm.model.supercontig_152.56 | 1e-111 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6473 | 26 | 44 | Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G62360.1 | 5e-89 | KNOX/ELK homeobox transcription factor |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_152.56 |