PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_13.107 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 157aa MW: 16374.5 Da PI: 4.3 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 127.5 | 4.6e-40 | 1 | 71 | 30 | 100 |
NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100 +kadedv+misaeaP+l++kacelfilelt+rswlhaeenkrrtl+k+diaaa+trtdifdflvdivprde evm.model.supercontig_13.107 1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDE 71 9********************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 8.05E-24 | 1 | 69 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.5E-30 | 1 | 69 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.5E-14 | 1 | 54 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHAEEN KRRTLQKNDI AAAITRTDIF 60 DFLVDIVPRD EAAGLGGMVG ATASGVPYYY PPMGQPAGAA GPGGMMIGRP AVDPTGVYVQ 120 PPSQAWQSVW QTAATADDGS YGSGGSTGLG NLDGQG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 1e-41 | 1 | 69 | 27 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 41 | 47 | RRTLQKN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_13.107 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021905707.1 | 1e-111 | nuclear transcription factor Y subunit C-1 isoform X1 | ||||
Refseq | XP_021905708.1 | 1e-111 | nuclear transcription factor Y subunit C-1 isoform X2 | ||||
Swissprot | Q9SMP0 | 1e-84 | NFYC1_ARATH; Nuclear transcription factor Y subunit C-1 | ||||
TrEMBL | A0A0A0LNK7 | 2e-95 | A0A0A0LNK7_CUCSA; Uncharacterized protein | ||||
STRING | evm.model.supercontig_13.107 | 1e-110 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM478 | 28 | 160 | Representative plant | OGRP315 | 17 | 117 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G48590.1 | 3e-65 | nuclear factor Y, subunit C1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_13.107 |
Publications ? help Back to Top | |||
---|---|---|---|
|