PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_124.57 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 25201 Da PI: 8.3614 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.2 | 3.8e-18 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd++l+d+++++G+g W++Ia+ g++R +k+c++rw++yl evm.model.supercontig_124.57 10 KGLWSEEEDKILIDYITLHGKGKWSRIAKLTGLKRGGKSCRLRWLNYL 57 678*****************************99************97 PP | |||||||
2 | Myb_DNA-binding | 57.5 | 3.1e-18 | 63 | 106 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg +++eE++l+++++++lG++ W++Ia +++ gRt++q+k++w++ evm.model.supercontig_124.57 63 RGDFSEEEEDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNT 106 899*******************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.004 | 5 | 57 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.52E-30 | 8 | 104 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.7E-13 | 9 | 59 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.7E-16 | 10 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.6E-22 | 11 | 64 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.09E-11 | 13 | 57 | No hit | No description |
PROSITE profile | PS51294 | 25.749 | 58 | 112 | IPR017930 | Myb domain |
SMART | SM00717 | 5.3E-17 | 62 | 110 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-17 | 63 | 106 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-24 | 65 | 112 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.51E-11 | 66 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048765 | Biological Process | root hair cell differentiation | ||||
GO:0090377 | Biological Process | seed trichome initiation | ||||
GO:0090378 | Biological Process | seed trichome elongation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MEDGKSEYKK GLWSEEEDKI LIDYITLHGK GKWSRIAKLT GLKRGGKSCR LRWLNYLCPT 60 VKRGDFSEEE EDLIIRLHNL LGNRWSLIAG RVPGRTDNQV KNHWNTRLSK RLGVKKGACK 120 TLSCKESKEE DPNPTSSTAS WNNRCQKRKI SEEGSDHQRC DNISGFININ YATNDLGSNY 180 QQFNVWVNTN NDDLNLQYTP NLIEFPDESP DFFWHGIX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-27 | 7 | 112 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_124.57 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021890857.1 | 1e-161 | transcription factor WER-like | ||||
Swissprot | Q9SEI0 | 5e-62 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A2N9H649 | 1e-71 | A0A2N9H649_FAGSY; Uncharacterized protein | ||||
STRING | evm.model.supercontig_124.57 | 1e-160 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 2e-64 | myb domain protein 66 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_124.57 |