PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1.422
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 788aa    MW: 88466.6 Da    PI: 5.733
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1.422genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS385.84.9e-1184147832373
                         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                  ++l++ cA+av + d++ a++lL+++++++sp gd mqR+a+yf+ +L+arla+s++e y+al  ++ s    +++l+ ++l
  evm.model.supercontig_1.422 414 RTLVTLCAQAVGAADNRSASELLKQIRQHSSPMGDGMQRMAHYFAIGLEARLAGSGTEAYAALVNKPVS---AADVLKGYHL 492
                                  678899**********************************************************99999...99******** PP

                         GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetge 163
                                  f  ++P+ k+s++  N++I + +e+++++HiiDf+i +G+QWp+L++ L+sR +gpp+lRiTgv+ p++g   ++++ee g+
  evm.model.supercontig_1.422 493 FLAACPFRKMSNFFSNKTIIKVAEKATKLHIIDFGILYGFQWPCLIHRLSSRHGGPPRLRITGVDLPQPGfrPAKRVEEAGR 574
                                  *********************************************************************9************ PP

                         GRAS 164 rLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                                  rLa++A++++vpfef++ +a++++++++e+L+++++E+l+Vn+ ++  +lldesv ++s+r++vL+l+++++P+v+++   +
  evm.model.supercontig_1.422 575 RLANYANTFKVPFEFSP-IAQKWDTIKIEDLKIESDEVLVVNCLYRFRNLLDESVVVDSPRNKVLNLIRKINPTVFILGIVN 655
                                  *****************.7*************************************************************** PP

                         GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                                    +n++ F +rf eal +ys+lfd+le+++pre +er+ vErel+gre++nv+acegaer+er et+++W++r  +aGF+++
  evm.model.supercontig_1.422 656 GTYNAPFFITRFREALFHYSTLFDMLETTVPREIQERMLVERELFGREVMNVIACEGAERIERPETYKQWQARNLRAGFRQL 737
                                  ********************************************************************************** PP

                         GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                  pl+e++ +  k  +++ + + + +ee+s++l++gWk+r ++++S+W
  evm.model.supercontig_1.422 738 PLNEEIKSMTKERVATNYHKDFVIEEDSKWLLQGWKGRIVYALSSW 783
                                  ***************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.415387764IPR005202Transcription factor GRAS
PfamPF035141.7E-115414783IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MVMDQPLGEF YGSLNRFRID DETFPVSSNQ NLIVFSQNYV NSASPLDPNS SKASLLSTVS  60
QEGDSHEDYD FSDVVLKYIS QMLMEEDIEE QNCMFQESSA ALQAAEKSLY ELIGEEYPPF  120
PNQKSVSKVD QKHESQDERH DLTCNYSSSI GCVSTSSLTD PGWYPPFPNH ESVSNVDQKH  180
ESPDEKRDLT SNCSSSISVV SPSYLADPGG NSDFGEHKSL CVALQTSSQS SPGSANSAAN  240
VVYGFMDSPV SNIRFPDIFD DRESVTRFKR GLEEASKFLP NSTNLSVGLG YSGLSIKDLK  300
EEPECIVVKA EKKVEEECSL DGSRGRKNPF PEDVFTESER RSKQSAFSTD SNVSPEMYDM  360
VLLQCGSGTE AALREAWQNE TNKNTQQNGQ LTGTSGGKSR RKKQERKKDI VDLRTLVTLC  420
AQAVGAADNR SASELLKQIR QHSSPMGDGM QRMAHYFAIG LEARLAGSGT EAYAALVNKP  480
VSAADVLKGY HLFLAACPFR KMSNFFSNKT IIKVAEKATK LHIIDFGILY GFQWPCLIHR  540
LSSRHGGPPR LRITGVDLPQ PGFRPAKRVE EAGRRLANYA NTFKVPFEFS PIAQKWDTIK  600
IEDLKIESDE VLVVNCLYRF RNLLDESVVV DSPRNKVLNL IRKINPTVFI LGIVNGTYNA  660
PFFITRFREA LFHYSTLFDM LETTVPREIQ ERMLVERELF GREVMNVIAC EGAERIERPE  720
TYKQWQARNL RAGFRQLPLN EEIKSMTKER VATNYHKDFV IEEDSKWLLQ GWKGRIVYAL  780
SSWVPAC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A4e-533967851379Protein SCARECROW
5b3h_D4e-533967851379Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_1.422
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021910422.10.0scarecrow-like protein 14
RefseqXP_021910424.10.0scarecrow-like protein 14
RefseqXP_021910425.10.0scarecrow-like protein 14
TrEMBLA0A067G0Q20.0A0A067G0Q2_CITSI; Uncharacterized protein
STRINGevm.model.supercontig_1.4220.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14