PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.TU.contig_33612.1

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 6891.77 Da PI: 10.6235

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.TU.contig_33612.1	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.1	1.8e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien s rqvtfskRrng++KKA ELSvLCdaevavi+fss+gklyeyss evm.TU.contig_33612.1 9 KKIENLSSRQVTFSKRRNGLMKKARELSVLCDAEVAVIVFSSSGKLYEYSS 59 78***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.324	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	6.8E-30	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.47E-37	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGRVEMKK IENLSSRQVT FSKRRNGLMK KARELSVLCD AEVAVIVFSS SGKLYEYSST 60 X

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-20	1	60	1	60	MEF2 CHIMERA
6byy_B	1e-20	1	60	1	60	MEF2 CHIMERA
6byy_C	1e-20	1	60	1	60	MEF2 CHIMERA
6byy_D	1e-20	1	60	1	60	MEF2 CHIMERA
6bz1_A	9e-21	1	60	1	60	MEF2 CHIMERA
6bz1_B	9e-21	1	60	1	60	MEF2 CHIMERA
6bz1_C	9e-21	1	60	1	60	MEF2 CHIMERA
6bz1_D	9e-21	1	60	1	60	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269\|PubMed:10318690, ECO:0000269\|PubMed:10662856, ECO:0000269\|PubMed:12226488, ECO:0000269\|PubMed:12743119, ECO:0000269\|PubMed:14615187, ECO:0000269\|PubMed:15084721, ECO:0000269\|PubMed:15686521, ECO:0000269\|PubMed:17521410, ECO:0000269\|PubMed:18305206, ECO:0000269\|PubMed:19269998, ECO:0000269\|PubMed:19767455, ECO:0000269\|PubMed:8953767}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.TU.contig_33612.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269\|PubMed:15686521}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008351603.2	4e-31	agamous-like MADS-box protein AGL18
Refseq	XP_009335207.1	3e-31	PREDICTED: agamous-like MADS-box protein AGL18 isoform X1
Refseq	XP_009335208.1	3e-31	PREDICTED: agamous-like MADS-box protein AGL18 isoform X2
Refseq	XP_009363196.1	3e-31	PREDICTED: agamous-like MADS-box protein AGL18 isoform X1
Refseq	XP_009363197.1	3e-31	PREDICTED: agamous-like MADS-box protein AGL18 isoform X2
Swissprot	Q38847	8e-30	AGL15_ARATH; Agamous-like MADS-box protein AGL15
TrEMBL	A0A498I396	8e-30	A0A498I396_MALDO; Uncharacterized protein
STRING	evm.TU.contig_33612.1	2e-35	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13790.1	3e-32	AGAMOUS-like 15

Link Out ? help Back to Top
Phytozome	evm.TU.contig_33612.1

Publications ? help Back to Top
Zheng Q,Zheng Y,Perry SE Decreased GmAGL15 expression and reduced ethylene synthesis may contribute to reduced somatic embryogenesis in a poorly embryogenic cultivar of Glycine max. Plant Signal Behav, 2014. [PMID:23838957] Perry SE,Zheng Q,Zheng Y Transcriptome analysis indicates that GmAGAMOUS-Like 15 may enhance somatic embryogenesis by promoting a dedifferentiated state. Plant Signal Behav, 2016. 11(7): p. e1197463 [PMID:27302197] Cosio C, et al. The class III peroxidase PRX17 is a direct target of the MADS-box transcription factor AGAMOUS-LIKE15 (AGL15) and participates in lignified tissue formation. New Phytol., 2017. 213(1): p. 250-263 [PMID:27513887] Zheng Q,Zheng Y,Ji H,Burnie W,Perry SE Gene Regulation by the AGL15 Transcription Factor Reveals Hormone Interactions in Somatic Embryogenesis. Plant Physiol., 2016. 172(4): p. 2374-2387 [PMID:27794101] Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis. Plant Cell, 2018. 30(3): p. 600-619 [PMID:29475938]