PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

evm.TU.contig_27553.5

Organism

Carica papaya

Taxonomic ID

3649

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica

Family

M-type_MADS

Protein Properties

Length: 72aa MW: 7995.81 Da PI: 11.2477

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
evm.TU.contig_27553.5	genome	ASGPB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	71.7	6.4e-23	18	61	3	46
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 i+ +n qvtf+kRr+gi+KKA+E+S+LC+ae+aviifs+ k+ evm.TU.contig_27553.5 18 IKKATNLQVTFAKRRAGIFKKASEISTLCGAEIAVIIFSPAKKV 61 8999************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	21.474	8	62	IPR002100	Transcription factor, MADS-box
SMART	SM00432	5.7E-24	8	66	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.58E-21	9	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-17	10	30	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.6E-22	17	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-17	30	45	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-17	45	66	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 72 aa Download sequence Send to blast
MEPPKKLKGR QMIEMVKIKK ATNLQVTFAK RRAGIFKKAS EISTLCGAEI AVIIFSPAKK 60 VFFLSVLLWK S*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	evm.TU.contig_27553.5

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC238637	3e-98	AC238637.1 Carica papaya BAC clone 99B01, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021910924.1	1e-34	agamous-like MADS-box protein AGL62
Refseq	XP_021911602.1	5e-34	agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	2e-24	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	D7TAE5	1e-22	D7TAE5_VITVI; Uncharacterized protein
TrEMBL	R0F0R7	1e-22	R0F0R7_9BRAS; Uncharacterized protein
STRING	evm.TU.contig_27553.5	4e-43	(Carica papaya)
STRING	evm.TU.contig_47064.2	4e-43	(Carica papaya)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	6e-27	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	evm.TU.contig_27553.5

Publications ? help Back to Top
Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]