PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.TU.contig_27313.1
Organism
Carica papaya
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family M-type_MADS
Protein Properties Length: 107aa    MW: 11955 Da    PI: 11.1137
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.TU.contig_27313.1genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.22.8e-251662349
                           --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                 SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                            +nksn qvtfskRr+g++KKA+ELS+LC+ae+a+iifs+++k++ +
  evm.TU.contig_27313.1 16 MNNKSNLQVTFSKRRAGLFKKASELSTLCGAEIAIIIFSPDQKVFSF 62
                           68******************************************988 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.46666IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-32665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-27791IPR002100Transcription factor, MADS-box
CDDcd002651.88E-34774No hitNo description
PRINTSPR004042.0E-20828IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251662IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-202843IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-204364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MVRKSKGRQK VEMAKMNNKS NLQVTFSKRR AGLFKKASEL STLCGAEIAI IIFSPDQKVF  60
SFGHPCVQTV LERFVSGNPP QTASGTMKLI EAHRNTSVRE LNMQLTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A9e-19792186Myocyte-specific enhancer factor 2A
3kov_B9e-19792186Myocyte-specific enhancer factor 2A
3kov_I9e-19792186Myocyte-specific enhancer factor 2A
3kov_J9e-19792186Myocyte-specific enhancer factor 2A
3p57_A9e-19792186Myocyte-specific enhancer factor 2A
3p57_B9e-19792186Myocyte-specific enhancer factor 2A
3p57_C9e-19792186Myocyte-specific enhancer factor 2A
3p57_D9e-19792186Myocyte-specific enhancer factor 2A
3p57_I9e-19792186Myocyte-specific enhancer factor 2A
3p57_J9e-19792186Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269|PubMed:18334668}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.TU.contig_27313.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2385901e-147AC238590.1 Carica papaya BAC clone 12I03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021911902.11e-74agamous-like MADS-box protein AGL62, partial
SwissprotQ9FKK24e-45AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0A067EEZ42e-53A0A067EEZ4_CITSI; Uncharacterized protein
TrEMBLA0A2N9GC171e-53A0A2N9GC17_FAGSY; Uncharacterized protein
TrEMBLV4SG261e-53V4SG26_9ROSI; Uncharacterized protein
STRINGevm.TU.contig_27313.16e-74(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-47AGAMOUS-like 62
Publications ? help Back to Top
  1. Xu W, et al.
    Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds.
    Plant Cell, 2016. 28(6): p. 1343-60
    [PMID:27233529]
  2. Figueiredo DD,Batista RA,Roszak PJ,Köhler C
    Auxin production couples endosperm development to fertilization.
    Nat Plants, 2015. 1: p. 15184
    [PMID:27251719]
  3. Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C
    Auxin production in the endosperm drives seed coat development in Arabidopsis.
    Elife, 2017.
    [PMID:27848912]
  4. Fiume E,Coen O,Xu W,Lepiniec L,Magnani E
    Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal.
    Plant Signal Behav, 2017. 12(8): p. e1339000
    [PMID:28613109]
  5. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]