PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_fgenesh3_pg.C_20344
Common NameCHLNCDRAFT_56806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
Family NF-YC
Protein Properties Length: 240aa    MW: 25025 Da    PI: 8.9325
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_fgenesh3_pg.C_20344genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC44.33.8e-141131762184
                       NF-YC  21 lPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavt 84 
                                 +P   +k+i+ +d++v+++sa+a   ++ka elf+ +l+ r+  ha+  kr+ +k  d+a +  
  estExt_fgenesh3_pg.C_20344 113 FPTGVVKRIMMVDDEVQRVSADAVRAIAKATELFVQQLAARALQHAQAGKRKNFKEPDVAHVAG 176
                                 78889******************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003981.6E-9175IPR009071High mobility group box domain
SuperFamilySSF470957.59E-13170IPR009071High mobility group box domain
CDDcd013907.52E-10270No hitNo description
Gene3DG3DSA:1.10.30.106.8E-14272IPR009071High mobility group box domain
PROSITE profilePS5011813.141275IPR009071High mobility group box domain
PfamPF005052.9E-11271IPR009071High mobility group box domain
SuperFamilySSF471131.32E-13112176IPR009072Histone-fold
PfamPF008082.4E-12113173IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.4E-17113179IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MPPRGQTAYF LFSEEHRAAA KADLAAQDGA KAGVAQVAKL VGAKWAALSD EEKQQYKDRA  60
AAKTRQMKEE AAAAAAAQGQ QQQSPGGEGA AAGEEPAPAA VGGGGAAPPP FGFPTGVVKR  120
IMMVDDEVQR VSADAVRAIA KATELFVQQL AARALQHAQA GKRKNFKEPD VAHVAGRDRR  180
LVDMGLREVL EQHGATSGGG GEEGENAAAQ KQRNAKRQMQ EEAAAGTRQI TAFFNLEAT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005851642.11e-167hypothetical protein CHLNCDRAFT_56806
TrEMBLE1Z3U01e-166E1Z3U0_CHLVA; Uncharacterized protein
STRINGXP_005851642.11e-167(Chlorella variabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP46741111
Publications ? help Back to Top
  1. Blanc G, et al.
    The Chlorella variabilis NC64A genome reveals adaptation to photosymbiosis, coevolution with viruses, and cryptic sex.
    Plant Cell, 2010. 22(9): p. 2943-55
    [PMID:20852019]