PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.34.51.1 | ||||||||
Common Name | CHLNCDRAFT_28394 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 117aa MW: 13380.7 Da PI: 10.6491 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 71 | 2.2e-22 | 17 | 77 | 16 | 76 |
HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 16 eyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +r+++C h a +v+++g+eqrfCqqC+ fh +s+f+ ++rsCr+rL kh rrrk e_gw1.34.51.1 17 GCVQRYRICVEHRDAMSVVLKGQEQRFCQQCGTFHPISKFNGSRRSCRDRLRKHAIRRRKC 77 5679*******************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 18.366 | 1 | 77 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 7.5E-19 | 16 | 64 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 7.46E-19 | 16 | 78 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.7E-22 | 17 | 76 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MLLLFTPPRL VPTRKRGCVQ RYRICVEHRD AMSVVLKGQE QRFCQQCGTF HPISKFNGSR 60 RSCRDRLRKH AIRRRKCSDG SRPASWHWEE ELAGALGCAV LFPCCTAAWW LPVIPG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-12 | 21 | 76 | 29 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005843197.1 | 3e-81 | hypothetical protein CHLNCDRAFT_28394 | ||||
TrEMBL | E1ZST8 | 6e-80 | E1ZST8_CHLVA; Uncharacterized protein | ||||
STRING | XP_005843197.1 | 1e-80 | (Chlorella variabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP20 | 12 | 101 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69170.1 | 3e-16 | SBP family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17350547 |
Publications ? help Back to Top | |||
---|---|---|---|
|