PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.25.168.1 | ||||||||
Common Name | CHLNCDRAFT_27387 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 56aa MW: 6511.49 Da PI: 12.5823 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 60.3 | 5e-19 | 1 | 56 | 18 | 73 |
HHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS SBP 18 hrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 hr +++C +hs ap+v+++g+++rfCqq +rfh l f ++rsC L +h +rr e_gw1.25.168.1 1 HRSYRICVAHSTAPQVVLRGTSHRFCQQHGRFHLLAAFTGRQRSCAASLTRHRKRR 56 899***************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 17.486 | 1 | 56 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.2E-17 | 1 | 56 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-17 | 1 | 45 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 5.98E-16 | 1 | 56 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 56 aa Download sequence Send to blast |
HRSYRICVAH STAPQVVLRG TSHRFCQQHG RFHLLAAFTG RQRSCAASLT RHRKRR |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005844034.1 | 2e-32 | hypothetical protein CHLNCDRAFT_27387, partial | ||||
TrEMBL | E1ZQH1 | 5e-31 | E1ZQH1_CHLVA; Uncharacterized protein (Fragment) | ||||
STRING | XP_005844034.1 | 8e-32 | (Chlorella variabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP20 | 12 | 101 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G27370.4 | 2e-14 | squamosa promoter binding protein-like 10 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17351365 |
Publications ? help Back to Top | |||
---|---|---|---|
|