PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | e_gw1.12.292.1 | ||||||||
Common Name | CHLNCDRAFT_23935 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 177aa MW: 19567.6 Da PI: 9.913 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 90.2 | 1.6e-28 | 4 | 61 | 2 | 59 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 dDgynWrKYG K+vkgs+fprsYY+C+++gCp+kk +er+ + +++ + ++eHnh e_gw1.12.292.1 4 DDGYNWRKYGEKQVKGSPFPRSYYKCSHPGCPAKKMIEREPKTGRISQAELKNEHNHA 61 8********************************************************7 PP | |||||||
2 | WRKY | 105.4 | 3e-33 | 112 | 170 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+vers ++ +++++tYeg+H+h+ e_gw1.12.292.1 112 MDDGYRWRKYGQKIVKGNPHPRSYYKCTHPGCNVRKQVERSGRNARMLVTTYEGTHTHD 170 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 25.075 | 1 | 63 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 3.7E-25 | 3 | 63 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.7E-29 | 3 | 62 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.83E-23 | 3 | 63 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.5E-22 | 4 | 60 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 1.0E-33 | 99 | 172 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.7E-29 | 107 | 172 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 32.971 | 107 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.5E-39 | 112 | 171 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.2E-27 | 113 | 170 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0070370 | Biological Process | cellular heat acclimation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MANDDGYNWR KYGEKQVKGS PFPRSYYKCS HPGCPAKKMI EREPKTGRIS QAELKNEHNH 60 AKPGQRRRTP SAGVSPPADG AGPSGRRGSD AAEGGGGDER NVVELETDAD GMDDGYRWRK 120 YGQKIVKGNP HPRSYYKCTH PGCNVRKQVE RSGRNARMLV TTYEGTHTHD PPATTNG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-30 | 4 | 173 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 3e-30 | 4 | 173 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:21336597}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00494 | DAP | Transfer from AT5G07100 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:21336597}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005847104.1 | 1e-129 | hypothetical protein CHLNCDRAFT_23935, partial | ||||
Swissprot | Q9C5T3 | 3e-54 | WRK26_ARATH; Probable WRKY transcription factor 26 | ||||
TrEMBL | E1ZGV1 | 1e-128 | E1ZGV1_CHLVA; Uncharacterized protein (Fragment) | ||||
STRING | XP_005847104.1 | 1e-129 | (Chlorella variabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP469 | 16 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07100.2 | 1e-54 | WRKY DNA-binding protein 26 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17354544 |
Publications ? help Back to Top | |||
---|---|---|---|
|