PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | IGS.gm_1_00779 | ||||||||
Common Name | CHLNCDRAFT_133643 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Chlorella
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 78aa MW: 8783.85 Da PI: 11.2925 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 44.9 | 3.1e-14 | 2 | 44 | 36 | 78 |
TTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 36 sgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +g++qrfCq+C++f ls f kr+C+ L++hnerrr kq+ IGS.gm_1_00779 2 EGQQQRFCQKCGHFQLLSAFVGLKRTCQMALDQHNERRRDKQK 44 799************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51141 | 14.195 | 1 | 42 | IPR004333 | Transcription factor, SBP-box |
Gene3D | G3DSA:4.10.1100.10 | 4.8E-8 | 2 | 29 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.5E-13 | 2 | 41 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.23E-11 | 2 | 43 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MEGQQQRFCQ KCGHFQLLSA FVGLKRTCQM ALDQHNERRR DKQKRKRGQA WLGPSGNGDG 60 GGGAWAGRQQ QQQQQQK* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 40 | 46 | DKQKRKR |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_005852265.1 | 1e-47 | hypothetical protein CHLNCDRAFT_133643 | ||||
TrEMBL | E1Z3I3 | 3e-46 | E1Z3I3_CHLVA; Uncharacterized protein | ||||
STRING | XP_005852265.1 | 4e-47 | (Chlorella variabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP20 | 12 | 101 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76580.1 | 2e-08 | SBP family protein |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 17359228 |
Publications ? help Back to Top | |||
---|---|---|---|
|