PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

SRS

Protein Properties

Length: 91aa MW: 10009.5 Da PI: 11.3323

Description

SRS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF702	108.5	1.1e-33	4	81	3	78
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaa 65 +g C+dCGn+akkdC+h+RCRtCCk+rgfdC+thv+stWvpaa+rrer+ + +s+ snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 4 NGMRVCKDCGNRAKKDCSHRRCRTCCKTRGFDCSTHVRSTWVPAARRRERKMLMVGGASTIGG 66 56779*********************************************8776655544443 PP DUF702 66 sa..aeaaskrkrel 78 + +++ kr+r++ snap_masked-scaffold21955-abinit-gene-0.0-mRNA-1 67 GSsgSSSGVKRTRSN 81 332355556666654 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF05142	1.7E-30	7	81	IPR007818	Protein of unknown function DUF702
TIGRFAMs	TIGR01623	4.8E-26	8	50	IPR006510	Zinc finger, lateral root primordium type 1

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MVENGMRVCK DCGNRAKKDC SHRRCRTCCK TRGFDCSTHV RSTWVPAARR RERKMLMVGG 60 ASTIGGGSSG SSSGVKRTRS NPKKEFGLLN N

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269\|PubMed:12361963, ECO:0000269\|PubMed:16740145, ECO:0000269\|PubMed:16740146, ECO:0000269\|PubMed:18811619, ECO:0000269\|PubMed:20154152, ECO:0000269\|PubMed:22318676}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269\|PubMed:21976484}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006470560.1	2e-30	protein LATERAL ROOT PRIMORDIUM 1
Swissprot	Q9SD40	4e-24	SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBL	A0A2N9FMN3	8e-29	A0A2N9FMN3_FAGSY; Uncharacterized protein
TrEMBL	A0A2N9G8K1	6e-29	A0A2N9G8K1_FAGSY; Uncharacterized protein
TrEMBL	V4TGL8	7e-29	V4TGL8_9ROSI; Uncharacterized protein
STRING	XP_006470560.1	6e-30	(Citrus sinensis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF25300	2	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G36260.1	1e-27	Lateral root primordium (LRP) protein-related

Publications ? help Back to Top
Estornell LH,Landberg K,Cierlik I,Sundberg E SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis. Front Plant Sci, 2018. 9: p. 150 [PMID:29491878]