PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold17955-abinit-gene-0.3-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

MYB_related

Protein Properties

Length: 62aa MW: 7015.99 Da PI: 7.9741

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold17955-abinit-gene-0.3-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.7	3.5e-10	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+l +++ +G g+W+++++ g snap_masked-scaffold17955-abinit-gene-0.3-mRNA-1 14 RGLWSPEEDEKLFNYISTYGHGCWTSVPKFAG 45 789*************************9988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-14	6	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.31E-9	8	45	IPR009057	Homeodomain-like
PROSITE profile	PS51294	12.266	9	62	IPR017930	Myb domain
Pfam	PF00249	1.2E-8	14	46	IPR001005	SANT/Myb domain
CDD	cd00167	3.30E-7	17	46	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MRHHSCCNKQ NVKRGLWSPE EDEKLFNYIS TYGHGCWTSV PKFAGNIIDH CSPPLSLNAL 60 AI

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269\|PubMed:12753590, ECO:0000269\|PubMed:17147638, ECO:0000269\|PubMed:17329564}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by auxin. {ECO:0000269\|PubMed:23410518}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM034655	5e-35	KM034655.1 Jatropha curcas clone JcMYB035 MYB family protein gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023526355.1	1e-22	transcription factor MYB26-like isoform X2
Refseq	XP_023526357.1	1e-22	transcription factor MYB26-like isoform X2
Refseq	XP_027927252.1	2e-22	transcription factor MYB26-like isoform X2
Swissprot	Q9SPG3	8e-22	MYB26_ARATH; Transcription factor MYB26
TrEMBL	A0A396GCX3	4e-22	A0A396GCX3_MEDTR; Putative transcription factor MYB-HB-like family
STRING	XP_008447615.1	9e-22	(Cucumis melo)
STRING	XP_004141218.1	8e-22	(Cucumis sativus)
STRING	Lus10015608	1e-21	(Linum usitatissimum)
STRING	XP_010087725.1	1e-21	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF17500	4	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13890.2	3e-24	myb domain protein 26

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]