PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold03320-abinit-gene-0.8-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

M-type_MADS

Protein Properties

Length: 66aa MW: 7635.93 Da PI: 10.4599

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold03320-abinit-gene-0.8-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.3	3.7e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaevaviifs++g+lye+ss snap_masked-scaffold03320-abinit-gene-0.8-mRNA-1 9 KRIENATSRQVTFSKRRNGLLKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.576	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	5.4E-42	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.84E-30	3	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.64E-38	3	60	No hit	No description
PRINTS	PR00404	1.5E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MVRGKIQMKR IENATSRQVT FSKRRNGLLK KAYELSVLCD AEVAVIIFSQ KGRLYEFSST 60 EYVFLS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_R	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_S	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_A	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_B	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_C	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_D	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_E	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_F	4e-20	1	61	1	61	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269\|PubMed:21609362, ECO:0000269\|PubMed:21689171}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023878265.1	5e-37	MADS-box protein AGL42-like
Swissprot	Q9FIS1	9e-33	AGL42_ARATH; MADS-box protein AGL42
TrEMBL	A0A438CUW3	2e-36	A0A438CUW3_VITVI; MADS-box protein AGL42
STRING	VIT_16s0022g02400.t01	1e-35	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.4	3e-35	AGAMOUS-like 42