PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold02209-abinit-gene-0.36-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 107aa MW: 12646.5 Da PI: 6.5246 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 87.1 | 2.8e-27 | 2 | 105 | 271 | 374 |
GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvpls 330 ++a++p+e+++r E+e +gr+++nv+aceg er+er et+ kW+ r +aGF+++p++ snap_masked-scaffold02209-abinit-gene-0.36-mRNA-1 2 FDATMPNEDHQRLQFEKERIGRDAMNVIACEGLERVERPETFDKWEVRTLRAGFRQLPID 61 58999******************************************************* PP GRAS 331 ekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374 e+a+ ak ++ + + + + ++ +++++gWk+r ++++S+W+ snap_masked-scaffold02209-abinit-gene-0.36-mRNA-1 62 EEAVLVAKKAVNSEYHKDFVIYKDGQWMLQGWKGRIIYAISCWK 105 ************999888*************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 16.075 | 1 | 85 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 9.7E-25 | 2 | 105 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MFDATMPNED HQRLQFEKER IGRDAMNVIA CEGLERVERP ETFDKWEVRT LRAGFRQLPI 60 DEEAVLVAKK AVNSEYHKDF VIYKDGQWML QGWKGRIIYA ISCWKPA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023897036.1 | 9e-67 | scarecrow-like protein 14 | ||||
Swissprot | Q9SNB8 | 1e-37 | SCL30_ARATH; Scarecrow-like protein 30 | ||||
TrEMBL | A0A2N9G687 | 2e-49 | A0A2N9G687_FAGSY; Uncharacterized protein | ||||
TrEMBL | A0A2N9HNJ8 | 3e-49 | A0A2N9HNJ8_FAGSY; Uncharacterized protein | ||||
STRING | PGSC0003DMT400063769 | 7e-47 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14801 | 8 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46600.3 | 2e-40 | GRAS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|