PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | snap_masked-scaffold02091-abinit-gene-0.8-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 65aa MW: 7375.6 Da PI: 10.664 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.5 | 1.8e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n++ rqvtfskRr g++KKA+ELS+LCdae+a+++fs tgkl++y+s snap_masked-scaffold02091-abinit-gene-0.8-mRNA-1 9 KKIDNTTARQVTFSKRRRGLFKKAYELSTLCDAEIALLVFSATGKLFDYAS 59 78***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-28 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.29E-35 | 3 | 61 | No hit | No description |
PRINTS | PR00404 | 1.4E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.4E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
MTRKKIQIKK IDNTTARQVT FSKRRRGLFK KAYELSTLCD AEIALLVFSA TGKLFDYASS 60 SSCTH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021682197.1 | 6e-34 | MADS-box protein JOINTLESS-like isoform X1 | ||||
Refseq | XP_021682198.1 | 6e-34 | MADS-box protein JOINTLESS-like isoform X1 | ||||
Refseq | XP_021682199.1 | 6e-34 | MADS-box protein JOINTLESS-like isoform X1 | ||||
Refseq | XP_021682200.1 | 6e-34 | MADS-box protein JOINTLESS-like isoform X1 | ||||
Refseq | XP_023872463.1 | 1e-34 | MADS-box protein JOINTLESS-like | ||||
Swissprot | Q9FVC1 | 2e-28 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1L5JJJ6 | 1e-32 | A0A1L5JJJ6_HEVBR; MADS4 | ||||
TrEMBL | A0A2I4QQT2 | 1e-32 | A0A2I4QQT2_HEVBR; HbMADS-box protein | ||||
TrEMBL | B9S9I4 | 5e-33 | B9S9I4_RICCO; Mads box protein, putative | ||||
STRING | cassava4.1_020641m | 9e-34 | (Manihot esculenta) | ||||
STRING | XP_002522653.1 | 9e-34 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 7e-31 | MIKC_MADS family protein |