PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold01235-abinit-gene-0.19-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

M-type_MADS

Protein Properties

Length: 84aa MW: 9786.37 Da PI: 10.7009

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold01235-abinit-gene-0.19-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92	3e-29	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l +s snap_masked-scaffold01235-abinit-gene-0.19-mRNA-1 9 KRIENNTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLTHFS 58 79********************************************9997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	7.0E-38	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.815	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.71E-31	2	78	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.76E-35	2	75	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.4E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.3E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MGRVKLQIKR IENNTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLTHFSGK 60 RRIEDVLARY INLPDHDRGG YGFY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-19	1	78	1	79	MEF2C
5f28_B	3e-19	1	78	1	79	MEF2C
5f28_C	3e-19	1	78	1	79	MEF2C
5f28_D	3e-19	1	78	1	79	MEF2C
6bz1_A	2e-19	1	75	1	74	MEF2 CHIMERA
6bz1_B	2e-19	1	75	1	74	MEF2 CHIMERA
6bz1_C	2e-19	1	75	1	74	MEF2 CHIMERA
6bz1_D	2e-19	1	75	1	74	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023911967.1	4e-52	agamous-like MADS-box protein AGL104
Swissprot	Q9LM46	1e-41	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A1U8ARW1	2e-49	A0A1U8ARW1_NELNU; agamous-like MADS-box protein AGL104
TrEMBL	A0A2N9EUJ0	1e-49	A0A2N9EUJ0_FAGSY; Uncharacterized protein
STRING	XP_010269101.1	4e-50	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	5e-44	AGAMOUS-like 104

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]