PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

NF-YB

Protein Properties

Length: 138aa MW: 15447.3 Da PI: 4.8665

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	184.6	7.7e-58	19	114	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrkt 61 reqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrkt snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1 19 REQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKT 78 89******************************************************** PP NF-YB 62 ingddllwalatlGfedyveplkvylkkyrelegek 97 ingddllwa++tlGfe+yveplk+yl+k+re+ege+ snap_masked-scaffold01056-abinit-gene-0.13-mRNA-1 79 INGDDLLWAMTTLGFEEYVEPLKIYLQKFREMEGER 114 ********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	7.0E-55	13	118	IPR009072	Histone-fold
SuperFamily	SSF47113	9.01E-41	21	118	IPR009072	Histone-fold
Pfam	PF00808	9.3E-28	24	88	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	8.4E-22	52	70	No hit	No description
PROSITE pattern	PS00685	0	55	71	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	8.4E-22	71	89	No hit	No description
PRINTS	PR00615	8.4E-22	90	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
MADSDNDSGG QNNTNLSPRE QDRFLPIANV SRIMKRALPA NAKISKEAKE TVQECVSEFI 60 SFITGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYVEPL KIYLQKFREM EGERSTAAMG 120 GRHGDGRDGI GDDKQVML

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-48	19	109	2	92	Transcription factor HapC (Eurofung)
4g92_B	3e-48	19	109	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023874260.1	2e-91	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	1e-73	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A2N9GQW1	4e-81	A0A2N9GQW1_FAGSY; Uncharacterized protein
STRING	POPTR_0016s00780.1	1e-75	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-75	nuclear factor Y, subunit B3

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]