PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold07315-augustus-gene-0.6-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WOX
Protein Properties Length: 219aa    MW: 25263.4 Da    PI: 8.6269
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold07315-augustus-gene-0.6-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.71.5e-2181140357
                                                   --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                                      Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                                   +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  maker-scaffold07315-augustus-gene-0.6-mRNA-1  81 TRWNPTQEQIGILEMLYRGgMRTPNAQQIEQITAQLgkygKIEGKNVFYWFQNHKARERQ 140
                                                   7*****************99**************************************97 PP

2Wus_type_Homeobox118.52.9e-3881142465
                             Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                                                   tRW+Pt+eQi iLe+ly+ G+rtPn+++i++ita+L +yGkie+kNVfyWFQN+kaRerqkq
  maker-scaffold07315-augustus-gene-0.6-mRNA-1  81 TRWNPTQEQIGILEMLYRGGMRTPNAQQIEQITAQLGKYGKIEGKNVFYWFQNHKARERQKQ 142
                                                   8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.18776141IPR001356Homeobox domain
SuperFamilySSF466897.27E-1376146IPR009057Homeodomain-like
SMARTSM003891.2E-778145IPR001356Homeobox domain
CDDcd000862.75E-581142No hitNo description
PfamPF000463.0E-1981140IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-882140IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGSMKVHQFA RGLWEHEPSL TLGCKRLRPL APKLANTDTS GVTAFDLKSF IRPESGPRKL  60
GSSEDKDKRD PPQVETHPGG TRWNPTQEQI GILEMLYRGG MRTPNAQQIE QITAQLGKYG  120
KIEGKNVFYW FQNHKARERQ KQKRNSLGLS HCPRTPTAIT TITLDTRGEL EREEDSPYKR  180
KCRSWGFETL EEEEEEERRS CKEEGDRTLE LFPLHPESR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023876315.11e-145WUSCHEL-related homeobox 4
RefseqXP_023876316.11e-145WUSCHEL-related homeobox 4
SwissprotQ6X7J92e-78WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A1X9RU221e-160A0A1X9RU22_9ROSI; WUS
STRINGVIT_18s0001g10160.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61323452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.15e-73WUSCHEL related homeobox 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]
  3. Guo X, et al.
    Identification of cyst nematode B-type CLE peptides and modulation of the vascular stem cell pathway for feeding cell formation.
    PLoS Pathog., 2017. 13(2): p. e1006142
    [PMID:28158306]
  4. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]
  5. Kucukoglu M,Nilsson J,Zheng B,Chaabouni S,Nilsson O
    WUSCHEL-RELATED HOMEOBOX4 (WOX4)-like genes regulate cambial cell division activity and secondary growth in Populus trees.
    New Phytol., 2017. 215(2): p. 642-657
    [PMID:28609015]
  6. Yamaguchi YL, et al.
    Root-Knot and Cyst Nematodes Activate Procambium-Associated Genes in Arabidopsis Roots.
    Front Plant Sci, 2017. 8: p. 1195
    [PMID:28747918]