PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

maker-scaffold05403-augustus-gene-0.18-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

NAC

Protein Properties

Length: 199aa MW: 22656.2 Da PI: 8.4727

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
maker-scaffold05403-augustus-gene-0.18-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	136.3	2e-42	47	172	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFs 62 lppGfrF+Ptd+el+ +Lk+k++g++ ++ +++ev+ yk+ePwdL+ k ++++++ew+fF+ maker-scaffold05403-augustus-gene-0.18-mRNA-1 47 LPPGFRFSPTDKELIELFLKPKITGNDEDI-YFVPEVEFYKLEPWDLQyKsGIDTKDQEWFFFA 109 79***********************999.78**********95247777999** PP NAM 63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmhey 126 ++ ++++gk +nr+t++g Wk tg+d+e++s kg+++g+kktLvf+ gr++kg t+Wvmhey maker-scaffold05403-augustus-gene-0.18-mRNA-1 110 AQSLQHQKGKGRNRKTEKGHWKVTGNDREIKS-KGKVIGMKKTLVFHIGRSRKG--TKWVMHEY 170 ****************************.999*************7..9***** PP NAM 127 rl 128 r maker-scaffold05403-augustus-gene-0.18-mRNA-1 171 RT 172 96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.92E-47	43	179	IPR003441	NAC domain
PROSITE profile	PS51005	42.84	47	197	IPR003441	NAC domain
Pfam	PF02365	1.8E-25	48	171	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MHAKVTTCGT SCADDMKQGV DSPLATKYNA SCVCVCECVM EKLSLDLPPG FRFSPTDKEL 60 IELFLKPKIT GNDEDIYFVP EVEFYKLEPW DLQYKSGIDT KDQEWFFFAA QSLQHQKGKG 120 RNRKTEKGHW KVTGNDREIK SKGKVIGMKK TLVFHIGRSR KGTKWVMHEY RTTLKDLDGT 180 HPGQVGLLYS VCLIDVILT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-33	45	171	15	141	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-33	45	171	15	141	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-33	45	171	15	141	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-33	45	171	15	141	NO APICAL MERISTEM PROTEIN
3swm_A	4e-33	45	171	18	144	NAC domain-containing protein 19
3swm_B	4e-33	45	171	18	144	NAC domain-containing protein 19
3swm_C	4e-33	45	171	18	144	NAC domain-containing protein 19
3swm_D	4e-33	45	171	18	144	NAC domain-containing protein 19
3swp_A	4e-33	45	171	18	144	NAC domain-containing protein 19
3swp_B	4e-33	45	171	18	144	NAC domain-containing protein 19
3swp_C	4e-33	45	171	18	144	NAC domain-containing protein 19
3swp_D	4e-33	45	171	18	144	NAC domain-containing protein 19
4dul_A	4e-33	45	171	15	141	NAC domain-containing protein 19
4dul_B	4e-33	45	171	15	141	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269\|PubMed:17947243, ECO:0000269\|PubMed:18443413, ECO:0000269\|PubMed:22826500, ECO:0000269\|PubMed:24329768}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023872460.1	2e-87	NAC domain-containing protein 62-like
Swissprot	F4JN35	2e-46	NTL9_ARATH; Protein NTM1-like 9
TrEMBL	A0A2N9EGM8	1e-58	A0A2N9EGM8_FAGSY; Uncharacterized protein
STRING	XP_006441279.1	1e-47	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2065	25	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35580.1	8e-49	NAC transcription factor-like 9

Publications ? help Back to Top
Zheng XY, et al. Spatial and temporal regulation of biosynthesis of the plant immune signal salicylic acid. Proc. Natl. Acad. Sci. U.S.A., 2015. 112(30): p. 9166-73 [PMID:26139525] Guo T, et al. Lamin-like Proteins Negatively Regulate Plant Immunity through NAC WITH TRANSMEMBRANE MOTIF1-LIKE9 and NONEXPRESSOR OF PR GENES1 in Arabidopsis thaliana. Mol Plant, 2017. 10(10): p. 1334-1348 [PMID:28943325]