Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-B_box | 26.5 | 1.3e-08 | 18 | 54 | 4 | 40 |
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtvv 40
+ C+++++ + fC+ ++++lC +C ++ H++H++v
maker-scaffold02216-augustus-gene-0.18-mRNA-1 18 KLCDTCKSGSAAVFCRVDSVFLCLTCDSKLHSRHERV 54
68******99************************975 PP
|
2 | zf-B_box | 28.8 | 2.5e-09 | 54 | 99 | 3 | 42 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
++C+ +e+ +++ C+ + lC +C + +H+ H++vp+
maker-scaffold02216-augustus-gene-0.18-mRNA-1 54 VWMCEVCEQAPASVTCKADAAALCVTCDSDIHSAnplarrHERVPV 99
689*****************************66899999*99986 PP
|
3 | CCT | 69.9 | 6.6e-24 | 268 | 311 | 1 | 44 |
CCT 1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44
Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
maker-scaffold02216-augustus-gene-0.18-mRNA-1 268 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 311
9*****************************************97 PP
|
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AB931220 | 2e-47 | AB931220.1 Rubus palmatus gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: pYK-188_09. |
GenBank | AB931231 | 2e-47 | AB931231.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-308_09. |
GenBank | AB931232 | 2e-47 | AB931232.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-310_09. |
GenBank | AB931233 | 2e-47 | AB931233.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-311_09. |
GenBank | AB931235 | 2e-47 | AB931235.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr2-314_09. |
GenBank | AB931236 | 2e-47 | AB931236.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-279_09. |
GenBank | AB931237 | 2e-47 | AB931237.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-280_09. |
GenBank | AB931238 | 2e-47 | AB931238.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-284_09. |
GenBank | AB931239 | 2e-47 | AB931239.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-292_09. |
GenBank | AB931240 | 2e-47 | AB931240.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-295_09. |
GenBank | AB931241 | 2e-47 | AB931241.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-296_09. |
GenBank | AB931242 | 2e-47 | AB931242.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr3-300_09. |
GenBank | AB931244 | 2e-47 | AB931244.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-303-01_09. |
GenBank | AB931245 | 2e-47 | AB931245.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-303-02_09. |
GenBank | AB931246 | 2e-47 | AB931246.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-303-04_09. |
GenBank | AB931247 | 2e-47 | AB931247.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-303-06_09. |
GenBank | AB931248 | 2e-47 | AB931248.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-303-08_09. |
GenBank | AB931249 | 2e-47 | AB931249.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-305-06_09. |
GenBank | AB931250 | 2e-47 | AB931250.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-305-09_09. |
GenBank | AB931251 | 2e-47 | AB931251.1 Rubus sp. MM-2014 gene for zinc finger protein CONSTANS-LIKE homolog, partial cds, isolate: sr4-344_09. |