PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold02212-snap-gene-0.24-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 224aa MW: 26019.8 Da PI: 6.5111 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 25.3 | 3.3e-08 | 194 | 215 | 1 | 22 |
G2-like 1 kprlrWtpeLHerFveaveqLG 22 k r++W+ +LH++Fv+av+q+G maker-scaffold02212-snap-gene-0.24-mRNA-1 194 KHRVVWSVDLHQKFVKAVNQIG 215 68******************97 PP | |||||||
2 | Response_reg | 85.7 | 1.4e-28 | 19 | 127 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHH CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeir 66 vl+vdD+p+ +++l+++l+k y +v+++ ++eal+ll+e++ +D+++ D++mp+mdG++ll++ maker-scaffold02212-snap-gene-0.24-mRNA-1 19 VLVVDDDPTWLKILEKMLKKCAY-DVTTCHLAREALNLLRERKdgYDIVISDVNMPDMDGFKLLEHVG 85 89*********************.***************999999**********************6 PP HHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS Response_reg 67 eeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109 e +lp+i+++ ge + + + ++ Ga d+l Kp+ ++el++ maker-scaffold02212-snap-gene-0.24-mRNA-1 86 LEM-DLPVIMMSVDGETSKVMKGVQHGACDYLLKPIRMKELRN 127 644.8***********************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF52172 | 3.56E-36 | 16 | 139 | IPR011006 | CheY-like superfamily |
Gene3D | G3DSA:3.40.50.2300 | 4.8E-45 | 16 | 140 | No hit | No description |
SMART | SM00448 | 1.7E-32 | 17 | 129 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 42.833 | 18 | 133 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 1.3E-25 | 19 | 128 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 6.50E-30 | 20 | 133 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-8 | 192 | 218 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0009735 | Biological Process | response to cytokinin | ||||
GO:0010082 | Biological Process | regulation of root meristem growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 224 aa Download sequence Send to blast |
MENGFSSPRS ESFPAGLRVL VVDDDPTWLK ILEKMLKKCA YDVTTCHLAR EALNLLRERK 60 DGYDIVISDV NMPDMDGFKL LEHVGLEMDL PVIMMSVDGE TSKVMKGVQH GACDYLLKPI 120 RMKELRNIWQ HVFRKKIHEI RDIEHENIDI IQMSRNGSDL DDGHMYCGED FNSKKRKDFD 180 KNDDKDFGDH STKKHRVVWS VDLHQKFVKA VNQIGFDSKY SINF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ab5_A | 5e-16 | 17 | 135 | 2 | 122 | CHEY |
1ab5_B | 5e-16 | 17 | 135 | 2 | 122 | CHEY |
1ab6_A | 4e-16 | 17 | 135 | 2 | 122 | CHEMOTAXIS PROTEIN CHEY |
1ab6_B | 4e-16 | 17 | 135 | 2 | 122 | CHEMOTAXIS PROTEIN CHEY |
3olv_A | 5e-16 | 17 | 135 | 6 | 126 | Chemotaxis protein CheY |
3olv_B | 5e-16 | 17 | 135 | 6 | 126 | Chemotaxis protein CheY |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00010 | PBM | Transfer from AT1G67710 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023922783.1 | 1e-143 | two-component response regulator ARR11 | ||||
Swissprot | Q5N6V8 | 1e-100 | ORR26_ORYSJ; Two-component response regulator ORR26 | ||||
TrEMBL | A0A2N9IAG2 | 1e-133 | A0A2N9IAG2_FAGSY; Uncharacterized protein | ||||
STRING | POPTR_0010s06290.1 | 1e-125 | (Populus trichocarpa) | ||||
STRING | EMJ28155 | 1e-124 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3999 | 33 | 60 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G67710.1 | 5e-79 | response regulator 11 |
Publications ? help Back to Top | |||
---|---|---|---|
|