PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | maker-scaffold02077-snap-gene-0.44-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 70aa MW: 8251.59 Da PI: 11.5264 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 92.6 | 1.9e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l +s maker-scaffold02077-snap-gene-0.44-mRNA-1 9 KRIENNTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSHFS 58 79********************************************9997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 29.857 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.7E-28 | 2 | 63 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.70E-34 | 2 | 58 | No hit | No description |
PRINTS | PR00404 | 1.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.6E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MGRVKLEIKR IENNTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSHFSGR 60 RRWYNVNTTH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6byy_A | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_B | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_C | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6byy_D | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_A | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_B | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_C | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6bz1_D | 1e-18 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
6c9l_A | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 9e-19 | 1 | 59 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024027649.1 | 1e-37 | agamous-like MADS-box protein AGL104 | ||||
Swissprot | Q9LM46 | 1e-32 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
TrEMBL | W9SH44 | 7e-37 | W9SH44_9ROSA; MADS-box transcription factor 13 | ||||
STRING | XP_010105873.1 | 1e-37 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G22130.1 | 5e-35 | AGAMOUS-like 104 |
Publications ? help Back to Top | |||
---|---|---|---|
|