PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

maker-scaffold00195-augustus-gene-1.22-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

M-type_MADS

Protein Properties

Length: 108aa MW: 12285.2 Da PI: 10.1486

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
maker-scaffold00195-augustus-gene-1.22-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.5	8.2e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ie+ks rqvtfskRrng++KKA ELS+LCd+e+a+ ifsstgklyey+s maker-scaffold00195-augustus-gene-1.22-mRNA-1 10 QIEDKSSRQVTFSKRRNGLMKKARELSILCDVEAALFIFSSTGKLYEYCS 59 79**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.31	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.3E-36	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.95E-34	3	61	No hit	No description
SuperFamily	SSF55455	7.98E-28	3	65	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-27	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.5E-26	11	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-27	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MKRGKLQLNQ IEDKSSRQVT FSKRRNGLMK KARELSILCD VEAALFIFSS TGKLYEYCSS 60 DRFSPFFNFH TPLITKFTVG INMKDSPSCS KINDDRSTLA GFMEAGKQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-19	1	61	1	61	MEF2C
5f28_B	1e-19	1	61	1	61	MEF2C
5f28_C	1e-19	1	61	1	61	MEF2C
5f28_D	1e-19	1	61	1	61	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable MADS-box transcription factor that functions with J2 and EJ2 in meristem maturation. {ECO:0000269\|PubMed:28528644}.
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.
UniProt	Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:25183521, ECO:0000269\|PubMed:7632923}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023872295.1	4e-35	MADS-box transcription factor 14-like
Swissprot	K4BND8	7e-23	MADS4_SOLLC; MADS-box protein 04g005320
Swissprot	P29383	8e-23	AGL3_ARATH; Agamous-like MADS-box protein AGL3
Swissprot	Q9XJ61	4e-23	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A2N9IT15	2e-29	A0A2N9IT15_FAGSY; Uncharacterized protein
STRING	Pavir.Bb00065.1.p	1e-25	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	1e-25	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462] Soyk S, et al. Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene. Cell, 2017. 169(6): p. 1142-1155.e12 [PMID:28528644]