PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family WOX
Protein Properties Length: 200aa    MW: 22950.3 Da    PI: 6.8058
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.9e-212282257
                                                          T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHH CS
                                              Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRake 55
                                                          r+R+++t+eql++Le++Fe+ n +p+ ++++e++++l    +++e++V++WFqNrRa+ 
  augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1 22 RQRWSPTTEQLQILERFFEEdNGTPNNQRIKEITTELaqhgKISESNVYNWFQNRRARL 80
                                                          79*****************99*************************************9 PP

                                                          HC CS
                                              Homeobox 56 kk 57
                                                          ++
  augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1 81 RR 82
                                                          97 PP

2Wus_type_Homeobox91.48.4e-302284365
                                     Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRe 61
                                                          r+RW+Pt+eQ++iLe+ +++   tPn+++i++it+eL+++Gki++ NV++WFQNr+aR 
  augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1 22 RQRWSPTTEQLQILERFFEEDNGTPNNQRIKEITTELAQHGKISESNVYNWFQNRRARL 80
                                                          79********************************************************* PP

                                     Wus_type_Homeobox 62 rqkq 65
                                                          r+kq
  augustus_masked-scaffold11225-abinit-gene-0.0-mRNA-1 81 RRKQ 84
                                                          **97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-161685IPR009057Homeodomain-like
PROSITE profilePS5007115.6451883IPR001356Homeobox domain
SMARTSM003899.6E-132087IPR001356Homeobox domain
SuperFamilySSF466895.56E-172184IPR009057Homeodomain-like
CDDcd000861.51E-132284No hitNo description
PfamPF000461.3E-182282IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MRQGSLYYDA WIASSGQKMN IRQRWSPTTE QLQILERFFE EDNGTPNNQR IKEITTELAQ  60
HGKISESNVY NWFQNRRARL RRKQSVPEPQ KPESETAKEV QSLKEKKMRP ESTLSYENSA  120
QRSKTIHLQQ GPETSTEILR LNSRSNEGEP TFPSDSDLSF SGSLGHMSFV PTPGTNRFGE  180
MEVPGNYNPY CYGEGYDMAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023908230.11e-141WUSCHEL-related homeobox 8-like
TrEMBLA0A2N9HA521e-103A0A2N9HA52_FAGSY; Uncharacterized protein
STRINGVIT_18s0122g01140.t016e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.13e-36WUSCHEL related homeobox 13