PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | augustus_masked-scaffold05722-abinit-gene-0.1-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 95aa MW: 10341.5 Da PI: 7.815 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 103.8 | 1.1e-32 | 26 | 82 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 +vrY eC+kNhAas+Gg+avDGC+Efm+s geegt al+CaACgCHRnFH+reve+e augustus_masked-scaffold05722-abinit-gene-0.1-mRNA-1 26 TVRYAECQKNHAASVGGYAVDGCREFMAS-GEEGTNGALTCAACGCHRNFHKREVETE 82 79**************************9.999*********************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD125774 | 2.0E-26 | 1 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Pfam | PF04770 | 1.7E-30 | 27 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.1E-26 | 28 | 79 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.819 | 29 | 78 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MRKRQVVVRR EEPSRCSTTS AQTITTVRYA ECQKNHAASV GGYAVDGCRE FMASGEEGTN 60 GALTCAACGC HRNFHKREVE TEVGYEHVAI SSNGT |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_023910537.1 | 2e-63 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 3e-34 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | A0A2N9G5H9 | 7e-48 | A0A2N9G5H9_FAGSY; Uncharacterized protein | ||||
STRING | EOY03457 | 7e-46 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1550 | 34 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28917.1 | 1e-36 | mini zinc finger 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|