 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | augustus_masked-scaffold05095-abinit-gene-0.4-mRNA-1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 66aa MW: 7605.86 Da PI: 10.9156 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.3 | 7.6e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+ey++
augustus_masked-scaffold05095-abinit-gene-0.4-mRNA-1 9 KRIENKINRQVTFSKRRGGLLKKAHEISVLCDAEVALIVFSHKGKLFEYAT 59
79***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.268 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.67E-37 | 2 | 61 | No hit | No description |
| SuperFamily | SSF55455 | 3.92E-30 | 2 | 63 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.5E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.4E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.5E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.5E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRGGLLK KAHEISVLCD AEVALIVFSH KGKLFEYATD 60 SWDGFR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-22 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_B | 3e-22 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_C | 3e-22 | 1 | 63 | 1 | 63 | MEF2C |
| 5f28_D | 3e-22 | 1 | 63 | 1 | 63 | MEF2C |
| 6bz1_A | 3e-22 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_B | 3e-22 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_C | 3e-22 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| 6bz1_D | 3e-22 | 1 | 63 | 1 | 63 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB775533 | 2e-72 | AB775533.1 Fagus crenata AP1 mRNA for MADS-box transcription factor, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007156376.1 | 6e-37 | hypothetical protein PHAVU_003G2810000g, partial | ||||
| Refseq | XP_014624024.1 | 5e-36 | truncated transcription factor CAULIFLOWER A isoform X2 | ||||
| Refseq | XP_028206840.1 | 5e-36 | truncated transcription factor CAULIFLOWER A-like isoform X2 | ||||
| Swissprot | Q38876 | 1e-34 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
| TrEMBL | A0A151TRY3 | 2e-37 | A0A151TRY3_CAJCA; Agamous-like MADS-box protein AGL8 isogeny | ||||
| STRING | XP_007156376.1 | 2e-36 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 5e-37 | AGAMOUS-like 8 | ||||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|