PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

NF-YB

Protein Properties

Length: 126aa MW: 14592.2 Da PI: 4.7765

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	163.4	3.1e-51	18	113	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrek 58 +eq+r+lPianv+rimk+ lP nakisk+aket+qecvsefisfvtseas+kc++e+ augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1 18 KEQERLLPIANVGRIMKQSLPLNAKISKEAKETMQECVSEFISFVTSEASEKCRKER 74 89***************************************************** PP NF-YB 59 rktingddllwalatlGfedyveplkvylkkyrelegek 97 rkt+ngdd++wal lGf+dy p++ yl++yrele e+ augustus_masked-scaffold02980-abinit-gene-0.4-mRNA-1 75 RKTVNGDDVCWALEALGFDDYSGPIRRYLHRYRELEVER 113 *********************************9886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.0E-50	11	119	IPR009072	Histone-fold
SuperFamily	SSF47113	6.99E-38	20	116	IPR009072	Histone-fold
Pfam	PF00808	3.7E-27	23	87	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	2.9E-16	51	69	No hit	No description
PROSITE pattern	PS00685	0	54	70	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	2.9E-16	70	88	No hit	No description
PRINTS	PR00615	2.9E-16	89	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 126 aa Download sequence Send to blast
MDDNVGASDP NEDNNNIKEQ ERLLPIANVG RIMKQSLPLN AKISKEAKET MQECVSEFIS 60 FVTSEASEKC RKERRKTVNG DDVCWALEAL GFDDYSGPIR RYLHRYRELE VERANQDRVR 120 DNEREA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	2e-42	17	108	1	92	Transcription factor HapC (Eurofung)
4g92_B	2e-42	17	108	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023904256.1	4e-77	nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	1e-53	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A2N9IB20	1e-73	A0A2N9IB20_FAGSY; Uncharacterized protein
STRING	XP_002516901.1	2e-67	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	4e-56	nuclear factor Y, subunit B5

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]