PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

augustus_masked-scaffold00852-abinit-gene-0.0-mRNA-1

Organism

Castanea mollissima

Taxonomic ID

60419

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea

Family

MYB

Protein Properties

Length: 212aa MW: 24231 Da PI: 5.8399

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
augustus_masked-scaffold00852-abinit-gene-0.0-mRNA-1	genome	THGP	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.6	1.6e-19	30	77	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+++++ +G ++W+tIa + g++R++k+c++rw++yl augustus_masked-scaffold00852-abinit-gene-0.0-mRNA-1 30 KGAWTAEEDSKLAEVIAIHGAKRWTTIATKAGLNRCGKSCRLRWLNYL 77 79********************************************97 PP
2	Myb_DNA-binding	50.6	4.3e-16	83	128	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l augustus_masked-scaffold00852-abinit-gene-0.0-mRNA-1 83 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 128 78999***************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.274	25	81	IPR017930	Myb domain
SuperFamily	SSF46689	4.03E-29	28	124	IPR009057	Homeodomain-like
SMART	SM00717	5.4E-16	29	79	IPR001005	SANT/Myb domain
Pfam	PF00249	4.1E-18	30	77	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.0E-24	31	84	IPR009057	Homeodomain-like
CDD	cd00167	4.67E-11	32	77	No hit	No description
PROSITE profile	PS51294	20.703	82	132	IPR017930	Myb domain
SMART	SM00717	1.9E-15	82	130	IPR001005	SANT/Myb domain
Pfam	PF00249	1.8E-14	83	128	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.3E-25	85	132	IPR009057	Homeodomain-like
CDD	cd00167	4.70E-10	87	128	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 212 aa Download sequence Send to blast
MASMADRSIK REVNAMEAIN NVSTKKEVNK GAWTAEEDSK LAEVIAIHGA KRWTTIATKA 60 GLNRCGKSCR LRWLNYLRPN IKRGNISDQE EDLILRLHKL LGNRWSLIAG RLPGRTDNEI 120 KNYWNSHLSK KLRQKEKQSV AATRDGYTVQ ENREEDKVNE EMSGEENTSK GVDDSKSDFD 180 VDEFFDFSNE STLNLDWVSQ FLELDQGFSD VS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-30	27	132	24	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269\|PubMed:10589676, ECO:0000269\|PubMed:11585796, ECO:0000269\|PubMed:14627722, ECO:0000269\|PubMed:15361138, ECO:0000269\|PubMed:15795220, ECO:0000269\|PubMed:16207757}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269\|PubMed:11910008, ECO:0000269\|PubMed:16176989}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023909039.1	1e-137	transcription factor WER-like isoform X1
Swissprot	Q9SEI0	5e-53	WER_ARATH; Transcription factor WER
TrEMBL	A0A2N9FU83	1e-126	A0A2N9FU83_FAGSY; Uncharacterized protein
STRING	EOY27239	1e-103	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2148	32	88

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G14750.1	4e-55	myb domain protein 66

Publications ? help Back to Top
Savage N, et al. Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana. PLoS ONE, 2013. 8(10): p. e75452 [PMID:24130712] Cheng Y, et al. Brassinosteroids control root epidermal cell fate via direct regulation of a MYB-bHLH-WD40 complex by GSK3-like kinases. Elife, 2018. [PMID:24771765] Kiefer CS, et al. Correction: Arabidopsis AIP1-2 restricted by WER-mediated patterning modulates planar polarity. Development, 2015. 142(5): p. 1022 [PMID:25715402] Kwak SH,Song SK,Lee MM,Schiefelbein J TORNADO1 regulates root epidermal patterning through the WEREWOLF pathway in Arabidopsis thaliana. Plant Signal Behav, 2015. 10(12): p. e1103407 [PMID:26451798] Zhu Y, et al. The Histone Chaperone NRP1 Interacts with WEREWOLF to Activate GLABRA2 in Arabidopsis Root Hair Development. Plant Cell, 2017. 29(2): p. 260-276 [PMID:28138017] Canales J,Contreras-López O,Álvarez JM,Gutiérrez RA Nitrate induction of root hair density is mediated by TGA1/TGA4 and CPC transcription factors in Arabidopsis thaliana. Plant J., 2017. 92(2): p. 305-316 [PMID:28771873] Mira MM, et al. Expression of Arabidopsis class 1 phytoglobin (AtPgb1) delays death and degradation of the root apical meristem during severe PEG-induced water deficit. J. Exp. Bot., 2017. 68(20): p. 5653-5668 [PMID:29059380] Kohanová J, et al. Root hair abundance impacts cadmium accumulation in Arabidopsis thaliana shoots. Ann. Bot., 2018. 122(5): p. 903-914 [PMID:29394308]