PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold00670-abinit-gene-0.16-mRNA-1
Organism
Castanea mollissima
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family M-type_MADS
Protein Properties Length: 58aa    MW: 6659.92 Da    PI: 10.5666
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold00670-abinit-gene-0.16-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF771.4e-24946138
                                                           S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
                                                 SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
                                                           krienk+nrqvtf+kRrng+lKKA+ELSvLCdaev++ 
  augustus_masked-scaffold00670-abinit-gene-0.16-mRNA-1  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVLIC 46
                                                           79*********************************864 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-26158IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.918145IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-23146IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-22323IPR002100Transcription factor, MADS-box
PfamPF003195.7E-211048IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-223858IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 58 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVLICFSVS ALIDFAFK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor active in inflorescence development and floral organogenesis.
UniProtProbable transcription factor. Functions with SEPALLATA1/AGL2 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4892681e-41AM489268.2 Vitis vinifera contig VV78X113159.9, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622386.15e-24PREDICTED: MADS-box protein CMB1-like
RefseqXP_016438828.14e-24PREDICTED: MADS-box protein CMB1-like
SwissprotO040675e-24AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
SwissprotP293844e-24SEP2_ARATH; Developmental protein SEPALLATA 2
TrEMBLA0A151SPN85e-23A0A151SPN8_CAJCA; Agamous-like MADS-box protein AGL9 isogeny
STRINGPOPTR_0008s09780.19e-24(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.12e-26MIKC_MADS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Maejima K, et al.
    Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen.
    Plant Signal Behav, 2015. 10(8): p. e1042635
    [PMID:26179462]
  3. Wang X, et al.
    An exon skipping in a SEPALLATA-Like gene is associated with perturbed floral and fruits development in cucumber.
    J Integr Plant Biol, 2016. 58(9): p. 766-71
    [PMID:26936301]
  4. Li D, et al.
    FAR-RED ELONGATED HYPOCOTYL3 activates SEPALLATA2 but inhibits CLAVATA3 to regulate meristem determinacy and maintenance in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(33): p. 9375-80
    [PMID:27469166]
  5. Bonhomme F,Sommer H,Bernier G,Jacqmard A
    Characterization of SaMADS D from Sinapis alba suggests a dual function of the gene: in inflorescence development and floral organogenesis.
    Plant Mol. Biol., 1997. 34(4): p. 573-82
    [PMID:9247539]