PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | augustus_masked-scaffold00375-abinit-gene-1.0-mRNA-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 68aa MW: 7995.22 Da PI: 10.707 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 104.2 | 4.5e-33 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye+ss augustus_masked-scaffold00375-abinit-gene-1.0-mRNA-1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFSS 59 79***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.782 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.73E-38 | 2 | 61 | No hit | No description |
SuperFamily | SSF55455 | 3.66E-31 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-34 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-34 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-34 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 68 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFSST 60 SRYYHQNN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_B | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_C | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
5f28_D | 2e-21 | 1 | 61 | 1 | 61 | MEF2C |
6byy_A | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_A | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_B | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_C | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
6bz1_D | 2e-21 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015034 | 2e-65 | AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022850778.1 | 5e-37 | MADS-box protein EJ2-like | ||||
Swissprot | Q39685 | 1e-35 | CMB1_DIACA; MADS-box protein CMB1 | ||||
Swissprot | Q7Y040 | 1e-35 | EJ2_SOLLC; MADS-box protein EJ2 | ||||
TrEMBL | A0A151SPN8 | 3e-37 | A0A151SPN8_CAJCA; Agamous-like MADS-box protein AGL9 isogeny | ||||
STRING | POPTR_0003s16800.1 | 2e-36 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G24260.3 | 1e-37 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|