PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C026300P3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 182aa MW: 21229.5 Da PI: 9.8322 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.6 | 6.2e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s MELO3C026300P3 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP | |||||||
2 | K-box | 99.7 | 4.1e-33 | 83 | 171 | 10 | 98 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++ es+++e+ kLk++ e+Lqr+qR+llGedL++L+ keL+qLe+qLe+slk++Rs+K++++l+q+++lq+ke++l e+n+aL++k+ MELO3C026300P3 83 PAKELESSYREYVKLKSRFESLQRTQRNLLGEDLGPLNSKELEQLERQLESSLKQVRSTKTQYMLDQLSDLQNKEQMLIETNRALQMKV 171 5678999*******************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.66 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.32E-33 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.05E-42 | 2 | 76 | No hit | No description |
PRINTS | PR00404 | 5.6E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.6E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.4E-27 | 84 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 14.892 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0071486 | Biological Process | cellular response to high light intensity | ||||
GO:0071492 | Biological Process | cellular response to UV-A | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MGRGIVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST 60 SNMLKTLERY QKCSYGAVEV TKPAKELESS YREYVKLKSR FESLQRTQRN LLGEDLGPLN 120 SKELEQLERQ LESSLKQVRS TKTQYMLDQL SDLQNKEQML IETNRALQMK VINQYFYSYT 180 T* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ox0_A | 3e-37 | 75 | 173 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_B | 3e-37 | 75 | 173 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_C | 3e-37 | 75 | 173 | 1 | 103 | Developmental protein SEPALLATA 3 |
4ox0_D | 3e-37 | 75 | 173 | 1 | 103 | Developmental protein SEPALLATA 3 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF135962 | 0.0 | AF135962.1 Cucumis sativus CAGL2 (CAGL2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008464576.1 | 1e-119 | PREDICTED: developmental protein SEPALLATA 1 | ||||
Swissprot | P29382 | 1e-106 | SEP1_ARATH; Developmental protein SEPALLATA 1 | ||||
TrEMBL | A0A1S3CLU0 | 1e-117 | A0A1S3CLU0_CUCME; developmental protein SEPALLATA 1 | ||||
STRING | XP_008464576.1 | 1e-118 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15800.1 | 2e-95 | MIKC_MADS family protein |