PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C026269P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 186aa MW: 20363.9 Da PI: 7.8212 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 144.5 | 3e-45 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+ MELO3C026269P1 10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKELD 104 7*********************************************************************************************9 PP DUF260 96 llke 99 ++++ MELO3C026269P1 105 AANA 108 9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 27.852 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 4.1E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKLLNELLP 60 HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDAANADL IRFACNEIPN 120 AGVSHQVVQP SLGSTRPRAA LDQYHTSSTS GYYNHLPAFP MAYPLSWNEN ASGNNINEGG 180 RDGNI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-69 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-69 | 3 | 118 | 4 | 119 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00581 | DAP | Transfer from AT5G63090 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681814 | 0.0 | LN681814.1 Cucumis melo genomic scaffold, anchoredscaffold00089. | |||
GenBank | LN713256 | 0.0 | LN713256.1 Cucumis melo genomic chromosome, chr_2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008464527.1 | 1e-137 | PREDICTED: protein LATERAL ORGAN BOUNDARIES | ||||
Swissprot | Q9FML4 | 6e-73 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A1S3CN80 | 1e-136 | A0A1S3CN80_CUCME; protein LATERAL ORGAN BOUNDARIES | ||||
STRING | XP_008464527.1 | 1e-137 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1091 | 34 | 112 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 3e-75 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|