PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C026196P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 181aa MW: 20257.6 Da PI: 9.3271 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.6 | 3.1e-42 | 91 | 167 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 C v+gC +dls+ ++yhrrhkvCe hsk+p+v++ gl+qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+ MELO3C026196P1 91 CLVDGCVSDLSNYRDYHRRHKVCELHSKTPQVTIGGLTQRFCQQCSRFHSLDEFDEGKRSCRKRLDGHNRRRRKPQS 167 **************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.6E-34 | 83 | 152 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.633 | 88 | 165 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.27E-39 | 90 | 170 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.7E-32 | 91 | 164 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MDWNLKTPSW DFTQLEQDAL KNINTIGASS NFVEHITTSG DFTVDLKLGQ VSNLGTKYVV 60 NEPGVFKVTP SPSEPSKRAR GSGNGAQPSS CLVDGCVSDL SNYRDYHRRH KVCELHSKTP 120 QVTIGGLTQR FCQQCSRFHS LDEFDEGKRS CRKRLDGHNR RRRKPQSDSL SRSILSHYQG 180 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 5e-31 | 81 | 164 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 147 | 164 | KRSCRKRLDGHNRRRRKP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681814 | 0.0 | LN681814.1 Cucumis melo genomic scaffold, anchoredscaffold00089. | |||
GenBank | LN713256 | 0.0 | LN713256.1 Cucumis melo genomic chromosome, chr_2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008464414.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_008464415.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_008464416.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Refseq | XP_008464417.1 | 1e-131 | PREDICTED: squamosa promoter-binding-like protein 13A | ||||
Swissprot | B9DI20 | 4e-47 | SP13A_ARATH; Squamosa promoter-binding-like protein 13A | ||||
Swissprot | P0DI11 | 4e-47 | SP13B_ARATH; Squamosa promoter-binding-like protein 13B | ||||
Swissprot | Q0J0K1 | 1e-46 | SPL18_ORYSJ; Squamosa promoter-binding-like protein 18 | ||||
TrEMBL | A0A1S3CLF0 | 1e-130 | A0A1S3CLF0_CUCME; squamosa promoter-binding-like protein 13A | ||||
STRING | XP_008464414.1 | 1e-131 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2591 | 33 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 2e-49 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|