PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C023161P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 121aa MW: 13524.2 Da PI: 9.7709 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.9 | 7.2e-33 | 14 | 71 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e e++++ +rkpylheSRh hA+rR+Rg+gGrF MELO3C023161P1 14 EEPVYVNAKQYHGILRRRQSRAKAEVENRISRSQRKPYLHESRHLHAMRRERGCGGRF 71 69*******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.1E-34 | 12 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.108 | 13 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.8E-28 | 15 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.3E-24 | 16 | 38 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 18 | 38 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.3E-24 | 48 | 71 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MAQARMALPL AMAEEPVYVN AKQYHGILRR RQSRAKAEVE NRISRSQRKP YLHESRHLHA 60 MRRERGCGGR FLSKKKKVEA STSLDDDDDG EGSNISLGSE SMCNGSNCYQ GSQLHLSAYI 120 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 6e-23 | 14 | 77 | 2 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681880 | 1e-118 | LN681880.1 Cucumis melo genomic scaffold, anchoredscaffold00058. | |||
GenBank | LN713262 | 1e-118 | LN713262.1 Cucumis melo genomic chromosome, chr_8. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008460780.1 | 1e-83 | PREDICTED: nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q84JP1 | 2e-33 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A1S3CEE5 | 3e-82 | A0A1S3CEE5_CUCME; nuclear transcription factor Y subunit A-7-like | ||||
STRING | XP_008460780.1 | 5e-83 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.1 | 1e-35 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|