PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C023104P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

HSF

Protein Properties

Length: 103aa MW: 11818.4 Da PI: 5.8953

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C023104P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	79.7	4.6e-25	40	100	2	62
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+y+++ed+ ++++isw+++g++fvv+++ efak++Lpk Fkhsnf+SFvRQL +F MELO3C023104P1 40 FLMKTYRMVEDPGTDDVISWNSDGTAFVVWQTAEFAKDILPKLFKHSNFSSFVRQLIPMDF 100 9*******************************************************87777 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.0E-26	31	100	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	5.8E-15	36	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	2.18E-21	39	101	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	9.1E-21	40	100	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.7E-14	40	63	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.7E-14	78	90	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	2.7E-14	91	102	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MEAGVSDNNN NRNEEKKLES WPPWKAESEI RMRKSTTAPF LMKTYRMVED PGTDDVISWN 60 SDGTAFVVWQ TAEFAKDILP KLFKHSNFSS FVRQLIPMDF GK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5w_B	3e-19	37	102	1	66	Putative transcription factor
5d5x_B	3e-19	37	102	1	66	Putative transcription factor
5d5x_E	3e-19	37	102	1	66	Putative transcription factor
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription.
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:9645433}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681880	1e-163	LN681880.1 Cucumis melo genomic scaffold, anchoredscaffold00058.
GenBank	LN713262	1e-163	LN713262.1 Cucumis melo genomic chromosome, chr_8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008460754.2	7e-60	PREDICTED: heat stress transcription factor B-3
Swissprot	P22335	4e-27	HSF24_SOLPE; Heat shock factor protein HSF24
Swissprot	Q96320	3e-27	HSFB1_ARATH; Heat stress transcription factor B-1
TrEMBL	A0A1S3CD46	2e-58	A0A1S3CD46_CUCME; heat stress transcription factor B-3
STRING	XP_008460754.1	3e-59	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G36990.1	1e-29	heat shock factor 4

Publications ? help Back to Top
Scharf KD, et al. Three tomato genes code for heat stress transcription factors with a region of remarkable homology to the DNA-binding domain of the yeast HSF. EMBO J., 1990. 9(13): p. 4495-501 [PMID:2148291] Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis. Plant Cell Physiol., 2014. 55(10): p. 1772-8 [PMID:25138441] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Röth S,Mirus O,Bublak D,Scharf KD,Schleiff E DNA-binding and repressor function are prerequisites for the turnover of the tomato heat stress transcription factor HsfB1. Plant J., 2017. 89(1): p. 31-44 [PMID:27560701] Xu G, et al. uORF-mediated translation allows engineered plant disease resistance without fitness costs. Nature, 2017. 545(7655): p. 491-494 [PMID:28514448]