PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C018601P2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 219aa MW: 24379.8 Da PI: 6.3102 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 72.2 | 4.5e-23 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n rqv fskRr+g++KKA+EL +LCdae+ +++fs +gkl++y+s MELO3C018601P2 9 KKIDNIAARQVAFSKRRKGLFKKAKELAILCDAEIGLLVFSASGKLFDYAS 59 689**********************************************86 PP | |||||||
2 | K-box | 28.2 | 8e-11 | 91 | 165 | 18 | 92 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++ akL++e+e+ +e+R+++Ge+L+ L ++eL++Le+ L+ +l+++ + + e ++ +k + l eenk MELO3C018601P2 91 SNIRAKLNEEVEKKSHELRQMKGEELQGLGMEELKKLEKSLQGGLSRVAEIMDGKNSELLSVIGRKVDLLIEENK 165 55568******************************************9776555555555555555555555555 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.0E-34 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.118 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.83E-27 | 2 | 77 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.80E-35 | 3 | 75 | No hit | No description |
Pfam | PF00319 | 4.0E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.9E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 10.651 | 87 | 178 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 6.9E-8 | 95 | 169 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 219 aa Download sequence Send to blast |
MTRKKIQIKK IDNIAARQVA FSKRRKGLFK KAKELAILCD AEIGLLVFSA SGKLFDYASS 60 SIQEILERHN NVHSDNLPNL NEPSVELQLE SNIRAKLNEE VEKKSHELRQ MKGEELQGLG 120 MEELKKLEKS LQGGLSRVAE IMDGKNSELL SVIGRKVDLL IEENKRLNEL EVEKMGEQII 180 MQNIQGNSSE SVGNNSTSSN NPSQDYDSSD TSLKLGLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-18 | 1 | 100 | 1 | 91 | MEF2C |
5f28_B | 4e-18 | 1 | 100 | 1 | 91 | MEF2C |
5f28_C | 4e-18 | 1 | 100 | 1 | 91 | MEF2C |
5f28_D | 4e-18 | 1 | 100 | 1 | 91 | MEF2C |
6byy_A | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6byy_B | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6byy_C | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6byy_D | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6bz1_A | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6bz1_B | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6bz1_C | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
6bz1_D | 3e-18 | 1 | 70 | 1 | 70 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681792 | 2e-96 | LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034. | |||
GenBank | LN713255 | 2e-96 | LN713255.1 Cucumis melo genomic chromosome, chr_1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008455140.1 | 1e-152 | PREDICTED: MADS-box protein SVP-like isoform X1 | ||||
Swissprot | Q9FVC1 | 2e-66 | SVP_ARATH; MADS-box protein SVP | ||||
TrEMBL | A0A1S3C1G2 | 1e-151 | A0A1S3C1G2_CUCME; MADS-box protein SVP-like isoform X1 | ||||
STRING | XP_008455140.1 | 1e-152 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 2e-44 | MIKC_MADS family protein |