PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C017407P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

HD-ZIP

Protein Properties

Length: 215aa MW: 24645.6 Da PI: 8.4871

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C017407P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	57.4	2.5e-18	80	134	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ +++keq + Lee F+ + +++ ++++ LA++l+L++rqV vWFqNrRa+ k MELO3C017407P1 80 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTK 134 788899***********************************************98 PP
2	HD-ZIP_I/II	118.8	2.9e-38	80	168	1	90
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 +kk+rlskeq++lLEesF+ +++L+p +K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr + MELO3C017407P1 80 RKKLRLSKEQSTLLEESFKLHTTLNPAQKQALAQQLNLKTRQVEVWFQNRRARTKLKQTEVDCEFLKKCCERLNEENRRLKKELNELR-S 168 69*************************************************************************************9.4 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.6E-17	61	137	IPR009057	Homeodomain-like
SuperFamily	SSF46689	4.28E-18	65	137	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.2	76	136	IPR001356	Homeobox domain
SMART	SM00389	3.8E-15	78	140	IPR001356	Homeobox domain
CDD	cd00086	8.83E-14	80	137	No hit	No description
Pfam	PF00046	1.2E-15	80	134	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	111	134	IPR017970	Homeobox, conserved site
Pfam	PF02183	6.1E-9	136	169	IPR003106	Leucine zipper, homeobox-associated
SMART	SM00340	8.6E-19	136	179	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 215 aa Download sequence Send to blast
MEIDDDEVNS SEEDDDHHLM KRIRSNNNIV NYDHHHRQDS SFGSIRRLSS DQYINNNDIV 60 NSTNHNYKGI SSSGSELRER KKLRLSKEQS TLLEESFKLH TTLNPAQKQA LAQQLNLKTR 120 QVEVWFQNRR ARTKLKQTEV DCEFLKKCCE RLNEENRRLK KELNELRSLK LGASQLYIQL 180 PKAATLTICP SCDQITRTPA AVTAAAVDAN SPPQ*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	77	83	RERKKLR
2	128	136	RRARTKLKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269\|PubMed:10477292, ECO:0000269\|PubMed:11260495, ECO:0000269\|PubMed:8449400}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269\|PubMed:8106086}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681813	1e-176	LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBank	LN713256	1e-176	LN713256.1 Cucumis melo genomic chromosome, chr_2.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008453538.1	1e-157	PREDICTED: homeobox-leucine zipper protein HOX18-like
Swissprot	Q05466	5e-56	HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBL	A0A1S3BWH2	1e-155	A0A1S3BWH2_CUCME; homeobox-leucine zipper protein HOX18-like
STRING	XP_008453538.1	1e-156	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5664	28	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16780.1	9e-46	homeobox protein 2

Publications ? help Back to Top
Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development. Plant Signal Behav, 2014. [PMID:23838958] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Francisco M, et al. Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense. Front Plant Sci, 2016. 7: p. 1010 [PMID:27462337] Müller-Moulé P, et al. YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance. PeerJ, 2016. 4: p. e2574 [PMID:27761349] Ivarson E, et al. Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre. Front Plant Sci, 2016. 7: p. 2032 [PMID:28119714] Kasulin L, et al. A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina. Mol. Ecol., 2017. 26(13): p. 3389-3404 [PMID:28316114] Singh M,Gupta A,Singh D,Khurana JP,Laxmi A Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth. Sci Rep, 2017. 7(1): p. 16101 [PMID:29170398]