PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016678P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family STAT
Protein Properties Length: 624aa    MW: 69602.1 Da    PI: 6.1083
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016678P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT198.65.7e-621672871121
            STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkky 95 
                     ldv+ll++ gqpv k++evvasL+yadsg++veks+d+eapLL+sydGvef+s+drp+kll+GrasfklkisqLsskcdn+Lfri+f+ip+++ y
  MELO3C016678P1 167 LDVMLLDSSGQPVLKELEVVASLIYADSGEAVEKSGDEEAPLLASYDGVEFASSDRPSKLLHGRASFKLKISQLSSKCDNKLFRIRFCIPSVEGY 261
                     8********************************************************************************************** PP

            STAT  96 pfleavskpirCisrsrntrsssltk 121
                     pf+ea+s+pirCisrsrntr+s+l+ 
  MELO3C016678P1 262 PFFEALSSPIRCISRSRNTRMSTLML 287
                     ********************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498992.81E-540112IPR013320Concanavalin A-like lectin/glucanase domain
Gene3DG3DSA:3.30.505.108.5E-6549614IPR000980SH2 domain
SuperFamilySSF555508.46E-8553614IPR000980SH2 domain
PROSITE profilePS5000110.315556623IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 624 aa     Download sequence    Send to blast
MTPFLILSEW NRLKIMPLTT LHKADEGSSP GSSSSASVVP HEYLDVDFPM EKWVHIGCEV  60
STDFVRLHID GKMVGEKPVS SSLSEDTFPR GLGRIVLGNN GEDISLQGYV HNEKVLPSAS  120
LIRDHYAEDL PVKLFIDNSS TMEIEEGGDG IWNIVGGKPS CRRNFSLDVM LLDSSGQPVL  180
KELEVVASLI YADSGEAVEK SGDEEAPLLA SYDGVEFASS DRPSKLLHGR ASFKLKISQL  240
SSKCDNKLFR IRFCIPSVEG YPFFEALSSP IRCISRSRNT RMSTLMLKRS TFHSLDVSRS  300
SGLDNGTSEH EHVSVEEEKP SPLLKRVKSG QDRPTHNDDP SSGQPDEECN SHSFTANGAG  360
NGFGSRTERS KNNGSTGASP SDSGSTEARH SAPNRTRTNG NPISDVNIFK YCLAGLSERS  420
LLLKEIATSV SQEEILEFAE HVSLYSGCLH HRHQILMSRK LIEEGTRAWN SISQNKHHVH  480
WENVVFEIEE QFMRISGCSS RSLTQQDFEL LRRISGCQEY LTQESFERMW CWLYPVAFTL  540
SRQWINAMWS SLSPKWIEGF ITKEEAELSL QSPAGLQDPG TFILRFPTSR SWPHPDAGSL  600
VVTYVGNDYA LHHRLLTLDR IFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818610.0LN681861.1 Cucumis melo genomic scaffold, anchoredscaffold00029.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452431.10.0PREDICTED: uncharacterized protein LOC103493465 isoform X2
SwissprotQ56XZ10.0SHB_ARATH; SH2 domain-containing protein B
TrEMBLA0A1S3BTU90.0A0A1S3BTU9_CUCME; uncharacterized protein LOC103493465 isoform X2
STRINGXP_008452431.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.10.0SH2 domain protein B
Publications ? help Back to Top
  1. Yamada Y,Wang HY,Fukuzawa M,Barton GJ,Williams JG
    A new family of transcription factors.
    Development, 2008. 135(18): p. 3093-101
    [PMID:18701541]