PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C016042P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17494.3 Da PI: 4.8821 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 170.4 | 2.1e-53 | 45 | 141 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 v+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++ alatlGf+dy+epl+ yl +yr++eg MELO3C016042P1 45 VKEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICCALATLGFDDYAEPLRRYLVRYRDMEG 139 58********************************************************************************************* PP NF-YB 96 ek 97 e+ MELO3C016042P1 140 ER 141 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.5E-51 | 44 | 155 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.16E-38 | 48 | 157 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-27 | 51 | 115 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.1E-17 | 79 | 97 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 82 | 98 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-17 | 98 | 116 | No hit | No description |
PRINTS | PR00615 | 1.1E-17 | 117 | 135 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MDENTGMPER SVEFKYDFTG GGSSGVGGST GGSSEEAGNG VGGVVKEQDR LLPIANVGRI 60 MKQILPPNAK ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD ICCALATLGF 120 DDYAEPLRRY LVRYRDMEGE RAQQNKGCCN NNNNNNNNNN G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-44 | 45 | 136 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-44 | 45 | 136 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681803 | 0.0 | LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026. | |||
GenBank | LN713255 | 0.0 | LN713255.1 Cucumis melo genomic chromosome, chr_1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008451614.1 | 1e-116 | PREDICTED: nuclear transcription factor Y subunit B-1 | ||||
Swissprot | O82248 | 3e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1S3BT19 | 1e-115 | A0A1S3BT19_CUCME; nuclear transcription factor Y subunit B-1 | ||||
STRING | XP_008451614.1 | 1e-115 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-59 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|